DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and lipa

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001015847.2 Gene:lipa XenbaseID:XB-GENE-952977 Length:409 Species:Xenopus tropicalis

Alignment Length:413 Identity:121/414 (29%)
Similarity:187/414 (45%) Gaps:76/414 (18%)


  Fly    24 HSSPPESRYKWTTM---DWLEAQNVSHEVHNVTTADGYQLQLQRLPR------LGAKPVL-LVHG 78
            :|:.||:     ||   :.:..:....|.:.|.|.|||.|.:.|:|.      .|.|||: |.||
 Frog    39 YSADPEA-----TMNISELIRYRGYPSEEYEVLTEDGYILSVNRIPHGVKYASEGPKPVVFLQHG 98

  Fly    79 LLGSSLGWVCMGPERSLAFQLHHREYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFHEHGAYD 143
            ||.....||......||.|.|....||||:.|.|| :.:.|:|..|:....|||.||:.|....|
 Frog    99 LLADGSNWVTNLENNSLGFILADAGYDVWIGNSRG-NTWSRKHKSLSPDQEEFWAFSYDELAKKD 162

  Fly   144 LPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQVVLIGHSQ----AFNAFLVLCAVHPRFNQRIQ 204
            |||::|.:.|.||.|                 |:..:||||    ||.||..|    |:..::|:
 Frog   163 LPAVVDFITKKTGQE-----------------QIFYVGHSQGTTIAFIAFSSL----PQLAKKIK 206

  Fly   205 LIQALAPLARLHRQVRFDSFQVRR---LMKFIKKRQKAYKFEIFPPGYFRKVCQAKRDLCEY-YA 265
            :...|||:|    .|:|....:.:   |.:|:.: :...|.|..|..|.  :.......|.: .|
 Frog   207 MYFGLAPVA----TVKFSKSPLAKLGVLPEFLIE-ELFGKGEFLPQTYL--ITWLATHFCTHAIA 264

  Fly   266 KQLVGSAQNNKKLLEAFNYEYLLQ------------GGSPREIKHLQQIWKSGDFISYDFGTAEN 318
            .:|.|   |...||..||.:.|..            |.|.:.:.|.:|..:||:..::||||..|
 Frog   265 DELCG---NIFFLLSGFNEKNLNMSRVNVYSSHCPAGTSVQNMLHWRQGVRSGELKAFDFGTKGN 326

  Fly   319 LQVYHSVEALSYNISQITVPIILYFGETDAIATPEGVHAIYARMLRSVKSVRRINSKK---FNHL 380
            :..|:......|::..:|||..|:.|..|.:|..:.|    |.:|..|.::  :..|:   :.||
 Frog   327 MIHYNQTTPPFYHVRDMTVPTALWTGGNDWLADRKDV----ALLLTQVSNL--VYHKEIPDWEHL 385

  Fly   381 DFLISGDVKSLVNDKLIEHMEQF 403
            ||:...|....:.:::|..|::|
 Frog   386 DFIWGLDAPERMYNEIIAMMKKF 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 121/414 (29%)
Abhydro_lipase 48..90 CDD:282003 20/49 (41%)
lipaNP_001015847.2 Abhydro_lipase 49..110 CDD:282003 20/61 (33%)
PLN02872 50..409 CDD:215470 116/398 (29%)
Abhydrolase_5 91..>229 CDD:289465 56/164 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93975164
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D408561at33208
OrthoFinder 1 1.000 FOG0000092
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.769 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.