DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and Serhl2

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_008763997.1 Gene:Serhl2 RGDID:1563386 Length:328 Species:Rattus norvegicus

Alignment Length:354 Identity:77/355 (22%)
Similarity:111/355 (31%) Gaps:140/355 (39%)


  Fly    62 LQRLPRLGAKPVLLVHGLLGSSLGWVCMGPERSLAFQLHHREYDVWLANLRGVSPYGRQHIDLTD 126
            ||:.|     |||.:||                            ||.|....           |
  Rat    41 LQKNP-----PVLCLHG----------------------------WLDNANSF-----------D 61

  Fly   127 VMVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQVV------------- 178
            .::.|            ||....::|...||..|::...||.  ...||..|             
  Rat    62 KLIPF------------LPKDFCYVAMDFGGHGLSTHYSPGL--PYYHHNFVSEVRRVVSAFKWT 112

  Fly   179 ---LIGHSQAFNAFL--VLCAVHPRFNQRIQLIQALAPLARLHRQVRFDSFQVRRLMKFIKKR-Q 237
               |:|||  |...:  :...:.|....::.|:.: .||.       .|..:|..:|.:.:|. :
  Rat   113 RLSLLGHS--FGGVVGGLFACMFPEMVDKLILLDS-TPLL-------MDLNEVENIMTYRRKNIE 167

  Fly   238 KAYKFEIF--PPGYFRKVCQAKRDLCEYYAKQLVGSAQNNKKLLEAFNYEYLLQGGSPREIKHL- 299
            :..|.|..  |||.|    ..:..|.|...|        |..|.|... |.|||.|:.:..:.| 
  Rat   168 QTLKVEDSQKPPGIF----SPEEMLHELLTK--------NSHLNEDCG-ELLLQRGTTKVAEGLV 219

  Fly   300 ----QQI-WKSGDFISYDFGTAENLQVYHSVEALSYNISQITVPIILYFGETDAIATPEGVHAIY 359
                |:: |..   .|:||...|  ...||:..|     |.:|.||                   
  Rat   220 LNRDQRLSWPQ---YSFDFMGKE--LTMHSLRRL-----QASVLII------------------- 255

  Fly   360 ARMLRSVKSVRRINSKKFNHLDFLISGDV 388
             :.|.....|||.|.  .|...||:..|:
  Rat   256 -KALDGYYDVRREND--LNKASFLLMLDI 281

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 77/355 (22%)
Abhydro_lipase 48..90 CDD:282003 8/28 (29%)
Serhl2XP_008763997.1 MhpC 33..320 CDD:223669 77/355 (22%)
Abhydrolase_5 46..>155 CDD:289465 31/172 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.