DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and CG5377

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_651052.1 Gene:CG5377 FlyBaseID:FBgn0038974 Length:278 Species:Drosophila melanogaster

Alignment Length:209 Identity:37/210 (18%)
Similarity:65/210 (31%) Gaps:87/210 (41%)


  Fly   246 PPGYFRKVCQAKRDLCEYYAKQLVGSAQNNKKLLEAFN-------------YEYLLQGGSPREIK 297
            ||||.:.|...::...|::.:    .||....|:.|.:             ...|:..|...|..
  Fly    80 PPGYGKSVPPQRKFGLEFFRE----DAQAAVDLMRALDRPRFSILGWSDGGITALIVAGRHAEAV 140

  Fly   298 HLQQIWKSGDFISYDFGTA---------------ENLQVYHSVE------------ALSY----- 330
            ....||.:|.:::.|...|               |.::..:.||            |.::     
  Fly   141 DRLAIWGAGAYLNADEVKALKNIRDVAKWSPRMREPMEKVYGVERFPQLWAEWVDAACAFYDQRD 205

  Fly   331 ------NISQITVPIILYFGETDAIAT-------------------PEGVHAIYARMLRSVKSVR 370
                  .:.:|.:|..:..|:.|.:..                   |||.|.|:.|.        
  Fly   206 GDFCRTEVEKIKIPTFILHGKKDPMIAAEHIPWLRERLPHAEYYEFPEGKHNIHLRY-------- 262

  Fly   371 RINSKKFNHL--DF 382
               :::||.|  ||
  Fly   263 ---AEEFNKLVADF 273

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 37/210 (18%)
Abhydro_lipase 48..90 CDD:282003
CG5377NP_651052.1 MhpC 26..274 CDD:223669 37/210 (18%)
Abhydrolase_5 45..257 CDD:289465 30/181 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.