DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and LIPA

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_000226.2 Gene:LIPA HGNCID:6617 Length:399 Species:Homo sapiens

Alignment Length:421 Identity:122/422 (29%)
Similarity:180/422 (43%) Gaps:61/422 (14%)


  Fly    14 LIVCAIGRNAHSSPPESRYKWTTMDWLEAQNVSH---------EVHNVTTADGYQLQLQRLPR-- 67
            |:||.:....||.  .|..|.|.:|.....|||.         |.:.|.|.|||.|.|.|:|.  
Human     8 LVVCLVLWTLHSE--GSGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGR 70

  Fly    68 -----LGAKPVL-LVHGLLGSSLGWVCMGPERSLAFQLHHREYDVWLANLRGVSPYGRQHIDLTD 126
                 .|.|||: |.||||..|..||......||.|.|....:|||:.|.|| :.:.|:|..|:.
Human    71 KNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRG-NTWSRKHKTLSV 134

  Fly   127 VMVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQVVLIGHSQAFNAFLV 191
            ...|||.||:.|...|||||.|:.:...||.|                 ||..:||||......:
Human   135 SQDEFWAFSYDEMAKYDLPASINFILNKTGQE-----------------QVYYVGHSQGTTIGFI 182

  Fly   192 LCAVHPRFNQRIQLIQALAPLARLHRQVRF---DSFQVRRLMKFIKKRQKAYKFEIFPPGYFRK- 252
            ..:..|...:||::..||.|:|    .|.|   ...::.||...:.|.....| |..|...|.| 
Human   183 AFSQIPELAKRIKMFFALGPVA----SVAFCTSPMAKLGRLPDHLIKDLFGDK-EFLPQSAFLKW 242

  Fly   253 ----VCQ--AKRDLCEYYAKQLVGSAQNNKKLLEAFNY-EYLLQGGSPREIKHLQQIWKSGDFIS 310
                ||.  ..::||......|.|..:.|..:.....| .:...|.|.:.:.|..|..|...|.:
Human   243 LGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQA 307

  Fly   311 YDFG-TAENLQVYHSVEALSYNISQITVPIILYFGETDAIATPEGVHAIYARMLRSV--KSVRRI 372
            :|:| :|:|...|:.....:||:..:.||..::.|..|.:|....|:.:..::...|  :|:   
Human   308 FDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESI--- 369

  Fly   373 NSKKFNHLDFLISGDVKSLVNDKLIEHMEQF 403
              .::.||||:...|....:.:|:|..|.::
Human   370 --PEWEHLDFIWGLDAPWRLYNKIINLMRKY 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 119/412 (29%)
Abhydro_lipase 48..90 CDD:282003 22/50 (44%)
LIPANP_000226.2 PLN02872 38..396 CDD:215470 111/386 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C93976951
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D408561at33208
OrthoFinder 1 1.000 FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11005
Phylome 1 0.910 0.769 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.