DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and ephx1

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_957362.1 Gene:ephx1 ZFINID:ZDB-GENE-040426-913 Length:456 Species:Danio rerio

Alignment Length:352 Identity:71/353 (20%)
Similarity:121/353 (34%) Gaps:97/353 (27%)


  Fly   116 PYGRQHIDLTDVMVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQVVLI 180
            |.|.:.:.|  :||..|..||     |:...||..:.:.:..:.:..        |.|...:...
Zfish   136 PEGTRAVPL--MMVHGWPGSF-----YEFYGIISLLTEPSNPDDITF--------EVICPSIPGY 185

  Fly   181 GHSQAFN--AFLVLCAVHPRFN---QRIQLIQ-----------------ALAPLARLHRQVRF-- 221
            |.|:|.:  .|..:||.| .||   :|:...|                 .|.|.|.....:.|  
Zfish   186 GFSEASHKKGFDTVCAAH-IFNKLMKRLGFTQYYVQGGDWGSMITTNMAQLEPNAVKGLHINFAP 249

  Fly   222 ---DSFQVRRLMKFIKKRQKAYKF------EIFP------------PGYFR----KVCQAKRDLC 261
               .|..:...:.|.::..|.:.|      .:||            .||..    |...|.|.|.
Zfish   250 PAQGSVLMGLSLIFGRRFPKLFGFTEHDVKRLFPCMDKLVVDALRETGYMHIQATKPDTAGRGLN 314

  Fly   262 EYYAKQLVGSAQNNKKLLEAFN------YEYLLQGGSPRE------IKHLQQIWKSGDFISYDFG 314
            :    ..||.|   ..:||.|:      :..|..||..|:      :.::...|.||..||    
Zfish   315 D----SPVGLA---AYILEKFSTWTDPEFRKLEDGGLERKYSIDDLLTNVMIYWTSGCIIS---- 368

  Fly   315 TAENLQVYHSVEALSYNISQITVPIILYFG----ETDAIATPEGVHAIYARMLRSVKSVRRINSK 375
               :::.|........|.....:|:.:..|    ..:.:.||:.......|.|:|...:.|....
Zfish   369 ---SMRFYKENFGKGLNQPHAKLPVHVPTGVASFPNELLHTPKLWVTDKYRNLKSYTPIARGGHF 430

  Fly   376 KFNHLDFLISGDVKSLVNDKLIEHMEQ 402
            .......|::.||::.|  |::|:.::
Zfish   431 AAMEEPQLLAEDVQNFV--KIVENRKR 455

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 71/353 (20%)
Abhydro_lipase 48..90 CDD:282003
ephx1NP_957362.1 EHN 50..152 CDD:283978 6/18 (33%)
MhpC 114..450 CDD:223669 70/346 (20%)
Abhydrolase 124..>283 CDD:304388 33/163 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.