DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and CG5068

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001261609.1 Gene:CG5068 FlyBaseID:FBgn0035951 Length:409 Species:Drosophila melanogaster

Alignment Length:242 Identity:54/243 (22%)
Similarity:91/243 (37%) Gaps:68/243 (28%)


  Fly   201 QRIQLIQALAPLARLHRQVRFDSFQVRRLMKFIKKRQKAYKFEIFPPGYFRKVCQAKRDLC--EY 263
            ||..|...|.|.....|..|.|||:        |.|.:.||     ||.:.:....|.|:.  |.
  Fly     5 QRTMLKGKLPPTIPGGRIGRADSFK--------KSRIRDYK-----PGMWNEFFAEKEDVTVDEQ 56

  Fly   264 YAKQLVGSAQNNKK-----LLEAFNYEYL---------------------LQGGSPREIKHLQQI 302
            ...::..:.|..|.     ||....|..|                     ::|....::.....:
  Fly    57 RTFRIYRTKQPEKPGPVLLLLHGGGYSALTWAHFCSEVTSMIHCQCLCIDMRGHGDSKVDDEDDL 121

  Fly   303 WKSGDFISYDFGTAENLQVY-----------HSV-EALSYNISQIT-VPIILYFGETDAIATPEG 354
              |.|.::.|.|.. .|::|           ||: .|::.:.:.:. ||.::.....|.:   ||
  Fly   122 --SADTLAKDIGDL-ILKLYPEEVPQLFVVGHSMGGAIAVHFAHMALVPNLIGITVIDVV---EG 180

  Fly   355 VHAIYARMLRSVKSVRRINSKKF----NHLDFLI-SGDVKSLVNDKL 396
            . |:.|  |.|::|..|...|.|    |.:::.| ||.|:::.:.|:
  Fly   181 T-AMEA--LASMQSFLRSRPKYFQSIPNAIEWCIRSGQVRNVDSAKV 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 54/243 (22%)
Abhydro_lipase 48..90 CDD:282003
CG5068NP_001261609.1 MhpC 70..>204 CDD:223669 27/143 (19%)
Abhydrolase_5 73..>161 CDD:289465 14/91 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.