DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and CG1882

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001286169.1 Gene:CG1882 FlyBaseID:FBgn0033226 Length:454 Species:Drosophila melanogaster

Alignment Length:102 Identity:30/103 (29%)
Similarity:38/103 (37%) Gaps:18/103 (17%)


  Fly   211 PLARLHRQVRFDSFQVRRLMKFIKKRQKAYKFEIFPPGYFRKVCQAKRDL-CEYYAKQLVGSAQN 274
            ||..||......:..|..|..|.|.| ..|..:|...|...:...||..| ||   ||.|.|.:.
  Fly   114 PLVLLHGLGAGIALWVMNLDAFAKGR-PVYAMDILGFGRSSRPLFAKDALVCE---KQFVKSVEE 174

  Fly   275 NKKLLEAFNYEYLL---QGG---------SPREIKHL 299
            .::.:. .|...||   .||         .|..:|||
  Fly   175 WRREMN-INDMILLGHSMGGFIASSYALSHPERVKHL 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 30/103 (29%)
Abhydro_lipase 48..90 CDD:282003
CG1882NP_001286169.1 MhpC 114..382 CDD:223669 30/103 (29%)
Abhydrolase_5 114..>226 CDD:289465 30/103 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.