DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and CG18302

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_609420.1 Gene:CG18302 FlyBaseID:FBgn0032266 Length:406 Species:Drosophila melanogaster

Alignment Length:390 Identity:129/391 (33%)
Similarity:198/391 (51%) Gaps:43/391 (11%)


  Fly    36 TMDWLEAQNVSHEVHNVTTADGYQLQLQRLPRLGAKPVLLVHGLLGSSLGWVCMGPERSLAFQLH 100
            |.|.::......|.|.:...||:.|...|:|:.|.:|||||||||.||:.:|.:||||||.|.|.
  Fly    43 TPDLIKKYGYPAETHKIQAKDGFVLTAHRIPKPGGQPVLLVHGLLDSSVAYVILGPERSLGFLLS 107

  Fly   101 HREYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGG 165
            ...|||||.|.|| :.|.|:|........:||.|||||.|.|||||.||::        ||.   
  Fly   108 DMGYDVWLLNTRG-NRYSRKHKRYHRYQPQFWDFSFHELGVYDLPAAIDYV--------LAR--- 160

  Fly   166 PGQDEEQIHHQVVLIGHSQAFNAFLVLCAVHPRFNQRIQLIQALAPLARLHRQVRFDSFQVRRLM 230
             .:|.||||:    :||||...:|.|:.:....:.::|:|:|||||:      |.:|......::
  Fly   161 -SKDFEQIHY----VGHSQGTTSFFVMGSERSAYMKKIKLMQALAPV------VFWDYIDSPIIL 214

  Fly   231 KFIKKRQK----AYKFEI--FPP------GYFRKVCQ-AKRDLCEYYAKQLVG--SAQNNKKLLE 280
            .|:|..:.    |..|.|  |||      ....|:|. ..::.|.|:..:.:|  .||.|..||.
  Fly   215 TFVKYLRPLVFIARSFGIYEFPPENEVWRSLIHKICSFVFQNTCTYFLMEAMGVDYAQFNSSLLP 279

  Fly   281 AFNYEYLLQGGSPREIKHLQQIWKSGDFISYD-FGTAENLQVYHSVEA-LSYNISQITVPIILYF 343
            .|. .:...|.|.:.::|..|...||.|..|: :.|.||.: .|.|:. ..|.::.:...:.||:
  Fly   280 LFT-GHASSGSSVKSLEHYGQQIHSGGFFKYNYYSTWENRR-NHGVDTPPQYKLTNVDCKVALYY 342

  Fly   344 GETDAIATPEGVHAIYARMLRSVKSVRRINSKKFNHLDFLISGDVKSLVNDKLIEHMEQFFDGRL 408
            ...|.:.:.:.|..: ..:|.:|..........:||::|:...|||:::||::||.|.:..:|.:
  Fly   343 SRNDRLTSDKDVVRL-RDILPNVVLDYMFPDPLYNHINFIWGNDVKTVLNDRMIELMRKVDNGEV 406

  Fly   409  408
              Fly   407  406

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 129/388 (33%)
Abhydro_lipase 48..90 CDD:282003 20/42 (48%)
CG18302NP_609420.1 PLN02872 13..399 CDD:215470 128/382 (34%)
Abhydro_lipase 43..97 CDD:282003 22/54 (41%)
Abhydrolase_5 79..>208 CDD:289465 68/152 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130921356
eggNOG 1 0.900 E1_COG0596
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D408561at33208
OrthoFinder 1 1.000 FOG0000092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11005
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.