DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and Lip4

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001260356.1 Gene:Lip4 FlyBaseID:FBgn0032264 Length:448 Species:Drosophila melanogaster

Alignment Length:365 Identity:124/366 (34%)
Similarity:192/366 (52%) Gaps:33/366 (9%)


  Fly    48 EVHNVTTADGYQLQLQRLPRLGAKPVLLVHGLLGSSLGWVCMGPERSLAFQLHHREYDVWLANLR 112
            |.|.:.|.|||.|.|.|:.|.||.|||||||||.||..||.|||.:.|.:.|:.:.||||:||:|
  Fly    97 ENHTLETDDGYILTLHRIARPGATPVLLVHGLLDSSATWVMMGPNKGLGYLLYDQGYDVWMANVR 161

  Fly   113 GVSPYGRQHIDLTDVMVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQV 177
            | :.|.|:|:..:....:||.|:|||.|.:|:||.:|::...||..||             |:  
  Fly   162 G-NTYSRKHVKYSTHHAKFWDFTFHEMGKHDIPATMDYILNSTGVSQL-------------HY-- 210

  Fly   178 VLIGHSQAFNAFLVLCAVHPRFNQRIQLIQALAPLARL-HRQVRFDSF------QVRRLMKFIKK 235
              |||||....|.::.:..|.:..:|.|:|.|||:|.| |.:....:|      .|..::|.|..
  Fly   211 --IGHSQGTVVFWIMASEKPEYMDKIILMQGLAPVAFLKHCRSPVVNFLAEWHLSVSLVLKLIGV 273

  Fly   236 RQKAYKFEIFPPGYFRKVCQ---AKRDLCEYYAKQLVG--SAQNNKKLLEAFNYEYLLQGGSPRE 295
            .:...|.| |...:.|.:|.   ..:::|........|  ..|.|:.:|... ..:...|.|.::
  Fly   274 HEFLPKNE-FISMFNRIICDETTITKEICSNVIFLTTGFDKLQLNETMLPVI-VGHSPAGASTKQ 336

  Fly   296 IKHLQQIWKSGDFISYDFGTAENLQVYHSVEALSYNISQITVPIILYFGETDAIATPEGVHAIYA 360
            ::|..|:.:||.|..||.|...|..:|.:::..||::..:...:.||:|:.|.:|.||.|..: .
  Fly   337 MQHFGQLNRSGGFRQYDHGWLRNHWIYGTIDPPSYHLENVRAKVALYYGQNDWLAPPEDVEML-N 400

  Fly   361 RMLRSVKSVRRINSKKFNHLDFLISGDVKSLVNDKLIEHM 400
            |.|.:|.....::.|:||||||:...|.:.|:.|:::|.|
  Fly   401 RKLPNVVEKYLVDDKEFNHLDFIWGIDARELLWDRMLEIM 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 124/366 (34%)
Abhydro_lipase 48..90 CDD:282003 26/42 (62%)
Lip4NP_001260356.1 PLN02872 88..446 CDD:215470 124/366 (34%)
Abhydro_lipase 88..139 CDD:282003 26/42 (62%)
Abhydrolase_5 121..>253 CDD:289465 61/150 (41%)
Abhydrolase_5 <368..419 CDD:289465 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130921483
eggNOG 1 0.900 E1_COG0596
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D408561at33208
OrthoFinder 1 1.000 FOG0000092
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11005
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.