DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and SPCC1672.09

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_587880.1 Gene:SPCC1672.09 PomBaseID:SPCC1672.09 Length:467 Species:Schizosaccharomyces pombe

Alignment Length:397 Identity:111/398 (28%)
Similarity:168/398 (42%) Gaps:73/398 (18%)


  Fly    48 EVHNVTTADGYQLQLQRLP-----RLGAK-----PVLLV-HGLLGSSLGWVC-MGPERSLAFQLH 100
            |.|.|.|.|.|.|.:.|:.     |:|:.     ||:.. ||||.:|..||| :.|...|.|.|.
pombe    93 EDHLVRTEDDYILCIHRISKDSPGRIGSPHPKKLPVVYCHHGLLMNSEVWVCNVDPRNCLVFDLV 157

  Fly   101 HREYDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGG 165
            ::.|||||.|.|| :.|.|||:.......|||.||..:...||:|..||::.|.:|..:|     
pombe   158 NKGYDVWLGNNRG-NKYSRQHLRFDSTDKEFWDFSIDDFAQYDIPDTIDYILKTSGQTKL----- 216

  Fly   166 PGQDEEQIHHQVVLIGHSQAFNAFLVLCAVHPRFNQRIQLIQALAPLAR---LHRQVRFDSFQVR 227
                        ..||.||.........::||..|.:|..:.||||...   ||.:| .|:|...
pombe   217 ------------TYIGFSQGTAQAFASLSIHPLLNDKINSLIALAPAISPKGLHNRV-VDAFVKA 268

  Fly   228 R--LMKFIKKRQKAYKFEIFP-PGYFRKVCQAK--RDLCEYYAKQLVG-SAQNNKKLLEAFNYEY 286
            |  ::.|:..|:     .|.| .|:::.....|  ..:..|...||.. |.||........::.:
pombe   269 RPSILFFLFGRK-----SILPSAGFWQSFLAPKFFDAVLAYCLSQLFNWSCQNISSYQRLVSFAH 328

  Fly   287 LLQGGSPREIKHLQQIWKSGDFISYDFGTAENLQVYHS-----VEALSYNISQITVPIILYFGET 346
            |....|.:.:.|..||.:|.:|..||     |.|:.|.     .:|..:..:.|..||.|.:|.:
pombe   329 LYSYTSVKCLVHWFQIMRSAEFRMYD-----NDQLGHDYFLKYYKAAKFPTNNIRTPIYLIWGGS 388

  Fly   347 DAIATPEGVHAIYARMLRSVKS-VRRINSKKFNHLDFLISGDVKSLVNDKLI----------EHM 400
            |::...:.       ||.::.: |..:....:.|||.:.:..||..|...::          ||.
pombe   389 DSLVDIQA-------MLNALPAEVEHVKVDSYEHLDMIWADTVKDYVIPPVLRRLRDIHHPPEHE 446

  Fly   401 EQFFDGR 407
            |...:.|
pombe   447 ENDKENR 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 110/396 (28%)
Abhydro_lipase 48..90 CDD:282003 20/54 (37%)
SPCC1672.09NP_587880.1 Abhydro_lipase 81..145 CDD:282003 20/52 (38%)
Abhydrolase_1 127..422 CDD:278959 94/331 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.