DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and Lipk

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001192278.1 Gene:Lipk MGIID:2679259 Length:403 Species:Mus musculus

Alignment Length:390 Identity:112/391 (29%)
Similarity:173/391 (44%) Gaps:74/391 (19%)


  Fly    47 HEVHNVTTADGYQLQLQRLP-------RLGAKPVL-LVHGLLGSSLGWVCMGPERSLAFQLHHRE 103
            :|.|:|.|.|||.|...|:|       :...|.|: |.|||:.|:..|:|..|..||||.|....
Mouse    50 YEKHDVITEDGYILGTYRIPHGKGCSRKTAPKAVVYLQHGLIASANNWICNLPNNSLAFLLADSG 114

  Fly   104 YDVWLANLRGVSPYGRQHIDLTDVMVEFWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQ 168
            |||||.|.|| :.:.|.|:.|:....::|.||:.|...|||||.::.:.:.:|.:||        
Mouse   115 YDVWLGNSRG-NTWSRNHLRLSPKSPQYWAFSWDEMAKYDLPATVNLILEKSGQKQL-------- 170

  Fly   169 DEEQIHHQVVLIGHSQAFNAFLVLCAVHPRFNQRIQLIQALAPLARLHRQVRFDSFQVRRLMKFI 233
                     ..:||||......:..:.:|...::|:|..||||:|    .|::....:::|....
Mouse   171 ---------FYVGHSQGTTIAFIAFSTNPELAKKIRLFFALAPVA----TVKYTRSPMKKLTTLS 222

  Fly   234 KKRQKAY----------KFEIFPPGYFRKVCQAK--RDLCEYYAKQLVG-SAQN-NKKLLEAFNY 284
            :|..|..          .||.|   ...|||..|  ..||..:...|.| ..|| |...|:.   
Mouse   223 RKAVKVLFGDKMFSTHTWFEQF---IATKVCNRKLFHQLCSNFLFSLSGFDPQNLNMSRLDV--- 281

  Fly   285 EYLLQ---GGSPREIKHLQQIWKSGDFISYDFGTA-ENLQVYHSVEALSYNISQITVPIILYFGE 345
             ||.|   |.|.:.:.|..|...||...::|:|.. :|:..::.:....||||::.||..::.|.
Mouse   282 -YLSQSPAGTSVQNMLHWAQAVNSGQLQAFDWGNPDQNMMHFNQLTPPVYNISKMRVPTAMWSGG 345

  Fly   346 TDAIA--------TPEGVHAIYARMLRSVKSVRRINSKKFNHLDFLISGDVKSLVNDKLIEHMEQ 402
            .|.:|        .|:..:.||.:.:           ..:||:||.:..|....|...||..:|:
Mouse   346 QDVVADAKDTKNLLPKIANLIYYKEI-----------PHYNHMDFYLGQDAPQEVYGDLIRMIEE 399

  Fly   403  402
            Mouse   400  399

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 112/391 (29%)
Abhydro_lipase 48..90 CDD:282003 19/50 (38%)
LipkNP_001192278.1 Abhydro_lipase 40..101 CDD:282003 19/51 (37%)
Abhydrolase_5 82..>210 CDD:289465 50/150 (33%)
Abhydrolase_1 83..382 CDD:278959 96/339 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C94093463
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D408561at33208
OrthoFinder 1 1.000 FOG0000092
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11005
Phylome 1 0.910 0.769 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.