DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and EPHX2

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_001970.2 Gene:EPHX2 HGNCID:3402 Length:555 Species:Homo sapiens

Alignment Length:385 Identity:73/386 (19%)
Similarity:123/386 (32%) Gaps:127/386 (33%)


  Fly    68 LGAKP-VLLVHGLLGSSLGWVCMGPERSLAFQLHHREYDVWLANLRGVSPYGRQHIDLTDVMVEF 131
            ||:.| |.|.||...|...|....|      .|....|.|...:::|   ||.....        
Human   255 LGSGPAVCLCHGFPESWYSWRYQIP------ALAQAGYRVLAMDMKG---YGESSAP-------- 302

  Fly   132 WRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQVVLIGHSQAFNAFLVLCAVH 196
                         |.|.::..:|...|.:......|..      |.|.|||.........:...:
Human   303 -------------PEIEEYCMEVLCKEMVTFLDKLGLS------QAVFIGHDWGGMLVWYMALFY 348

  Fly   197 PRFNQRIQLIQAL-----------APLARLHRQVRFDSFQVRRLMKFIKKRQKAYKFEIFPPGYF 250
            |   :|::.:.:|           :||..:.....|| :|:                      ||
Human   349 P---ERVRAVASLNTPFIPANPNMSPLESIKANPVFD-YQL----------------------YF 387

  Fly   251 RKVCQAKRDLCEYYAKQLVG-------SAQNNKKLLEAFNYEYLLQGG----SPREIK------- 297
            ::...|:.:|.:..::....       |..:..|:.||        ||    ||.|..       
Human   388 QEPGVAEAELEQNLSRTFKSLFRASDESVLSMHKVCEA--------GGLFVNSPEEPSLSRMVTE 444

  Fly   298 -----HLQQIWKSGDFISYDFGTAENLQVYHSVE-----ALSYNISQITVPIILYFGETDAIATP 352
                 ::||..||        |....|..|.::|     |......:|.:|.::...|.|.:..|
Human   445 EEIQFYVQQFKKS--------GFRGPLNWYRNMERNWKWACKSLGRKILIPALMVTAEKDFVLVP 501

  Fly   353 EGVHAIYARMLRSVKSVRRINSKKFNHLDFLISGDVKSLVNDKLIEHMEQFFDGRLPYVI 412
            :    :...|...:..::|.:.:...|...:   |..:.||..||:.::.  |.|.|.|:
Human   502 Q----MSQHMEDWIPHLKRGHIEDCGHWTQM---DKPTEVNQILIKWLDS--DARNPPVV 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 70/379 (18%)
Abhydro_lipase 48..90 CDD:282003 9/23 (39%)
EPHX2NP_001970.2 Phosphatase 1..224
HAD_sEH-N_like 3..214 CDD:319790
Phosphate binding. {ECO:0000269|PubMed:15096040} 123..124
Epoxide hydrolase 235..555 73/386 (19%)
Abhydrolase_1 259..531 CDD:306935 63/357 (18%)
Microbody targeting signal. {ECO:0000255} 553..555 73/386 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.