DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and abhd-14

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:NP_500027.1 Gene:abhd-14 WormBaseID:WBGene00021927 Length:246 Species:Caenorhabditis elegans

Alignment Length:282 Identity:54/283 (19%)
Similarity:90/283 (32%) Gaps:95/283 (34%)


  Fly   173 IHHQVVLIGHSQAFNAFLVLCAVHPRFNQRIQLIQALAPLARLHRQVRFDSFQVRRLMKFIKKRQ 237
            :|||.:...|:......|:         :|..|...:...||          ::.:|:::.:.|.
 Worm     4 LHHQPLGSHHATTSGGSLL---------ERADLSHPIPENAR----------KLAQLVEYDESRV 49

  Fly   238 KAYKFEIF-----PPGYFRKVCQAKRDLCEYYAKQLV---------GSAQNNKKLLEAF---NYE 285
            :.....:|     |||             .:|:|..|         .|......||..|   .|.
 Worm    50 ELGTHSVFVREARPPG-------------AHYSKATVIFLHGQSFSSSTWTENNLLRTFAALGYR 101

  Fly   286 YL---LQGGSPREIKHLQQIWKSG---DFISYDFGTAENLQVYHSVEA------------LSYNI 332
            .:   |.|........:.|..|..   |||. ..|..:.:.|..|:.|            ||..:
 Worm   102 AIAIDLPGSGQTRGAAIPQAEKPNFLMDFIE-TLGLKQVMIVCASMAAQYVLPLMTSTRHLSCVV 165

  Fly   333 -------------SQITVPIILYFGETDAIATPEGVHAIYARMLRSVKSVRRINSKKFNHLDFLI 384
                         |..|||.::.:||.|....|...        .::|::.::..:|...     
 Worm   166 LVAPSNTHEVVSPSSYTVPTLVVWGERDTSLGPTAA--------ANLKNLPQVKLQKIPD----- 217

  Fly   385 SGDVKSLVNDKLIEHM-EQFFD 405
            :|....|.|.|..|:: ..|||
 Worm   218 AGHACYLHNPKCFENLCVNFFD 239

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 54/283 (19%)
Abhydro_lipase 48..90 CDD:282003
abhd-14NP_500027.1 MhpC 72..241 CDD:223669 37/183 (20%)
Abhydrolase_5 72..221 CDD:289465 30/163 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.