DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lip2 and ephx4

Sequence 1:NP_524667.1 Gene:Lip2 FlyBaseID:FBgn0024740 Length:413 Species:Drosophila melanogaster
Sequence 2:XP_002933851.2 Gene:ephx4 XenbaseID:XB-GENE-983897 Length:361 Species:Xenopus tropicalis

Alignment Length:350 Identity:76/350 (22%)
Similarity:116/350 (33%) Gaps:104/350 (30%)


  Fly    71 KP-VLLVHGLLGSSLGWVCMGPE--RSLAFQLHH--REYDVWLANLRGVSPYGRQHIDLTDVMVE 130
            || :||:||.           ||  .|...||..  .||.|...:|||   ||.     ||....
 Frog    91 KPLMLLLHGF-----------PEFWYSWRHQLREFKSEYRVVALDLRG---YGE-----TDAPTN 136

  Fly   131 FWRFSFHEHGAYDLPAIIDHMAKVTGGEQLASRGGPGQDEEQIHHQVVLIGHSQAFNAFLVLCAV 195
            .        .:|.|..||     |...|.:.|.|         :.:.|||||........:....
 Frog   137 I--------DSYKLDCII-----VDVKEIVDSLG---------YTKCVLIGHDWGGMIAWLTAIC 179

  Fly   196 HPRFNQRIQLIQALAPLARLHRQVRFDSFQVRRLMKFIKKRQKAYKFEIFPPGYFRKVCQAKRD- 259
            :|      :::..|..|:..|..| |..:.:|...:.||   ..|.| .|...:|.::.....| 
 Frog   180 YP------EMVTKLIVLSFPHPTV-FTEYILRHPSQLIK---SGYYF-FFQMPWFPELMYTVNDY 233

  Fly   260 --LCEYYAKQLVGSAQNNKKL----LEAFNYEYLLQGGSPREIKHLQQIWKSGDFISYDFGTAEN 318
              |.:.:.....|..::..:.    :||:.|.:...|.....:.|.:.|                
 Frog   234 KVLKDLFTSTDTGIGKHGCRFTEEDMEAYLYIFSQPGALSGPLNHYRNI---------------- 282

  Fly   319 LQVYHSVEALSYNISQITVPIILYFGETDAIATPEGVHAIYARMLRSVKSVRRINSKKFNHLDFL 383
                  ...|.....|:|:|.:|.:||.||....|            :..:.|:..|.:..|..|
 Frog   283 ------CSCLPLKHHQVTMPTLLLWGENDAFVEVE------------MAELTRVYVKNYFQLSVL 329

  Fly   384 ------ISGDVKSLVNDKLIEHMEQ 402
                  |..|...|||..:...:|:
 Frog   330 SYASHWIQQDQPELVNTLIWTFLEE 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lip2NP_524667.1 PLN02872 24..407 CDD:215470 76/350 (22%)
Abhydro_lipase 48..90 CDD:282003 6/20 (30%)
ephx4XP_002933851.2 Abhydrolase 64..>189 CDD:304388 36/145 (25%)
MhpC 78..348 CDD:223669 75/343 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0596
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.