DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED20 and med20

Sequence 1:NP_001260223.1 Gene:MED20 FlyBaseID:FBgn0013531 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001003585.1 Gene:med20 ZFINID:ZDB-GENE-040801-104 Length:212 Species:Danio rerio

Alignment Length:228 Identity:87/229 (38%)
Similarity:128/229 (56%) Gaps:23/229 (10%)


  Fly     1 MGVTILQPYPLPEGKSGAHIIDQLSKRLLALGATHAGQFLVDCETFISTPQPHNGAPGRAVHVLH 65
            ||||.:...|:.||||....:|.|.::|..|||...|.|.|||||:.:|... .|.|.:.::|:|
Zfish     1 MGVTCVCQVPVAEGKSVQQTVDLLHRKLEQLGAVKQGNFWVDCETYHATGNA-TGQPSKLLYVMH 64

  Fly    66 NSEYPASTFSIIDNGTGKQVAIVADNIFDLLMLKMTNTFTSKKQTKIESRGARFEYGDFVIKLGS 130
            |||.|.|..::.:.|.|    :.||..||:||:|:.:.|.:.|..|:||||.|:.|.||::|:|:
Zfish    65 NSEAPLSCMALFEGGPG----LSADANFDVLMIKLKSHFQNAKGHKVESRGTRYRYCDFLVKIGT 125

  Fly   131 VTMMEHFKGILIEIEYKSCVILAYCWEMIREMLQGFLGIAVNKDFPSYFAPQTIMTAMGQQQLHA 195
            |.|....:||.:|:||.:|||...||.:::|.:|.||| :...:.|:.|.              .
Zfish   126 VAMSSSARGISVEVEYCACVIPGDCWNLMKEFMQSFLG-SNTPELPTVFT--------------N 175

  Fly   196 KHNDIFEP---MDTVKQYLEQFTNYRKHVTLMG 225
            |...::.|   |||:.||||.|:..||...|.|
Zfish   176 KAEGLYVPVDCMDTMSQYLELFSKVRKQQVLPG 208

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED20NP_001260223.1 Med20 1..215 CDD:285776 83/217 (38%)
med20NP_001003585.1 Med20 1..197 CDD:285776 82/216 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C229167706
eggNOG 1 0.900 E1_KOG4309
Hieranoid 1 1.000
Homologene 1 1.000 H3158
Inparanoid 1 1.050 153 1.000 Inparanoid score I4235
OMA 1 1.010
OrthoDB 1 1.010 D1112080at2759
OrthoFinder 1 1.000 FOG0005190
OrthoInspector 1 1.000 T1052140
orthoMCL 1 0.900 OOG5_134088
Panther 1 1.100 LDO PTHR12465
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2634
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.