DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED20 and Med20

Sequence 1:NP_001260223.1 Gene:MED20 FlyBaseID:FBgn0013531 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001013196.1 Gene:Med20 RGDID:1306415 Length:212 Species:Rattus norvegicus

Alignment Length:221 Identity:89/222 (40%)
Similarity:131/222 (59%) Gaps:21/222 (9%)


  Fly     1 MGVTILQPYPLPEGKSGAHIIDQLSKRLLALGATHAGQFLVDCETF--ISTPQPHNGAPGRAVHV 63
            ||||.:...|:.||||....::.|:|:|..|||...|.|.|||||:  .::.....|..|:.::|
  Rat     1 MGVTCVSQMPVAEGKSVQQTVELLTKKLEMLGAEKQGTFCVDCETYHTAASTLGSQGQAGKLMYV 65

  Fly    64 LHNSEYPASTFSIIDNGTGKQVAIVADNIFDLLMLKMTNTFTSKKQTKIESRGARFEYGDFVIKL 128
            :||||||.|.|::.:||.    .::||..||:||:|:...|.|.|.:|||:||.|::|.||::|:
  Rat    66 MHNSEYPLSCFALFENGP----CLIADTNFDVLMVKLKGFFQSAKASKIETRGTRYQYCDFLVKV 126

  Fly   129 GSVTMMEHFKGILIEIEYKSCVILAYCWEMIREMLQGFLGIAVNKDFPSYFAPQTIMTAMGQQQL 193
            |:|||....:||.:|:||..||:.:.||.::.|.||.|||    ...|.  ||    |..|.   
  Rat   127 GTVTMGPSARGISVEVEYGPCVVASDCWSLLLEFLQSFLG----SHTPG--AP----TVFGN--- 178

  Fly   194 HAKHNDIFEPMDTVKQYLEQFTNYRK 219
              :|:.::.|.||:.||:|.|...||
  Rat   179 --RHDAVYGPADTMVQYMELFNKVRK 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED20NP_001260223.1 Med20 1..215 CDD:285776 87/216 (40%)
Med20NP_001013196.1 Med20 1..198 CDD:285776 87/216 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C229169882
eggNOG 1 0.900 E1_KOG4309
Hieranoid 1 1.000
Homologene 1 1.000 H3158
Inparanoid 1 1.050 162 1.000 Inparanoid score I4061
OMA 1 1.010
OrthoDB 1 1.010 D1112080at2759
OrthoFinder 1 1.000 FOG0005190
OrthoInspector 1 1.000 T1086392
orthoMCL 1 0.900 OOG5_134088
Panther 1 1.100 LDO PTHR12465
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.