DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED20 and med20

DIOPT Version :9

Sequence 1:NP_001260223.1 Gene:MED20 / 43952 FlyBaseID:FBgn0013531 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_593728.2 Gene:med20 / 2542421 PomBaseID:SPAC17G8.05 Length:193 Species:Schizosaccharomyces pombe


Alignment Length:185 Identity:38/185 - (20%)
Similarity:76/185 - (41%) Gaps:32/185 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ATHAGQFLVDCETFISTPQPHNGAPGRAVHVLHNSEYPASTFSIIDNGTGKQVAIVADNIFDLLM 97
            |.|..:::|..:.:      .|....:.:..|..:..| |..:.:|..|    .|.|:...:.::
pombe    31 AQHLKKWVVQYKLY------RNAVTPKTLEFLKQNINP-SMLACVDEAT----MIDAEPELEDII 84

  Fly    98 LKMTNTFTSKKQTKIESRGARFEYGDFVIKLGSVTMMEHFKGILIEIEYKSCVILAYCWEMIRE- 161
            :: |..:..::...||  |:.:|.|.|.:.:.:|.....:||||..:.|.....:.....:|:| 
pombe    85 VR-TKLWNFRQSFTIE--GSIYEVGSFKVAIANVLQKSVWKGILFHVTYDGTESVDLARPIIQEF 146

  Fly   162 MLQGFL--GIAVNKDFPSYFAPQTIMTAMGQQQLHAKHNDIF-----EPMDTVKQ 209
            .|:.||  ..:|...:.|:|          .|..|:..:.:.     :.:|||.|
pombe   147 FLKCFLQNNKSVTPVYESFF----------NQPRHSLDSKLLLQLFKQRIDTVSQ 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED20NP_001260223.1 Med20 1..215 CDD:285776 38/185 (21%)
med20NP_593728.2 Med20 25..180 CDD:312207 34/172 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104763
Panther 1 1.100 - - LDO PTHR12465
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.