DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MED20 and med20

Sequence 1:NP_001260223.1 Gene:MED20 FlyBaseID:FBgn0013531 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_002933024.2 Gene:med20 XenbaseID:XB-GENE-5950042 Length:211 Species:Xenopus tropicalis

Alignment Length:233 Identity:85/234 (36%)
Similarity:131/234 (56%) Gaps:29/234 (12%)


  Fly     1 MGVTILQPYPLPEGKSGAHIIDQLSKRLLALGATHAGQFLVDCETF------ISTPQPHNGAPGR 59
            ||||.:...||.||||....::.|:.:|..|||...|.|.|||||:      :.||    |..|:
 Frog     1 MGVTCVSQVPLAEGKSVQQTVEILTCKLEQLGAEKQGTFYVDCETYHTAGASMGTP----GQAGK 61

  Fly    60 AVHVLHNSEYPASTFSIIDNGTGKQVAIVADNIFDLLMLKMTNTFTSKKQTKIESRGARFEYGDF 124
            .::|:||||||.|||::.:||.    .:|||...|:||:|:...|.:.|..|:|:||.|::|.||
 Frog    62 LLYVMHNSEYPLSTFALFENGP----CLVADLNLDVLMVKLKGFFQNAKANKMETRGTRYQYCDF 122

  Fly   125 VIKLGSVTMMEHFKGILIEIEYKSCVILAYCWEMIREMLQGFLGIAVNKDFPSYFAPQTIMTAMG 189
            ::|:|:||:.:..:||.:|::|..|.:...||.::.|.:|.|:| :.....|..|:         
 Frog   123 LVKIGTVTVGQSGRGITVEVDYCPCAVPGDCWNLMVEFMQSFMG-SHAPSVPPVFS--------- 177

  Fly   190 QQQLHAKHNDIFEPMDTVKQYLEQFTNYRKHVTLMGGM 227
                 |||:.::.|.||:.||:|.....||....:.||
 Frog   178 -----AKHDPLYTPADTMVQYMELLNKIRKQQVTVAGM 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED20NP_001260223.1 Med20 1..215 CDD:285776 81/220 (37%)
med20XP_002933024.2 Med20 1..198 CDD:285776 81/220 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C229173726
eggNOG 1 0.900 E1_KOG4309
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H3158
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1112080at2759
OrthoFinder 1 1.000 FOG0005190
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.