DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wb and NetB

Sequence 1:NP_723870.1 Gene:wb FlyBaseID:FBgn0261563 Length:3375 Species:Drosophila melanogaster
Sequence 2:NP_001162753.1 Gene:NetB FlyBaseID:FBgn0015774 Length:793 Species:Drosophila melanogaster

Alignment Length:595 Identity:130/596 (22%)
Similarity:195/596 (33%) Gaps:202/596 (34%)


  Fly   132 GGGALRLLKTEDVYSSSFSGGLYPPLFNVVPRAQISVNATCGQNGAEEYCKQVGAKPCGICNAHS 196
            |..|..:...:..|.........|...|......:..::.||....|.||:.:.....|.|.:..
  Fly    22 GSSAAGISSNDPCYFEGKPRKCLPSFVNAAYGNPVQASSVCGAQQPERYCELLRDGNAGECRSCE 86

  Fly   197 SDRAKQRSIQSLISSGSGSGSGSGFEEGWWQS-----PTLQGGRQFEYVTILLDLKQTFQIFSVW 256
            ..|....::..|.:..:.:         .|:|     |........:.||:.|.|.:.:::..:.
  Fly    87 QQRYGPAALTDLNNPSNVT---------CWRSGAVNVPHDPDSAPPDNVTLTLSLGKKYELTYIS 142

  Fly   257 LK-SANSPRPASWILEKSLD-GINFEPWQYFGLSDADCQRRWNLSGQNGKYVFQNDTEIIC-STQ 318
            |. ...||||.|..:.||.| |..::|:|::   .:.||:.:. .....|....|:.|..| ::|
  Fly   143 LSFCPRSPRPDSLAIFKSSDFGQTWQPFQFY---SSQCQKFYG-RPDRAKISKFNEQEARCINSQ 203

  Fly   319 FSKPGPLENGVLHASLLKNRPGAT--DQSPELMKFITTRYIRIRLQGMH--------STAN---- 369
            ....|..:....:.  |:.||.|.  |.|..|..::|...||:....:.        ..||    
  Fly   204 HDTGGAAQRFAFNT--LEGRPSANDLDSSLVLQDWVTATDIRVVFHRLELPPQLLKVKNANAFSD 266

  Fly   370 -----------------------------QDNS------------------------LDWLLDSP 381
                                         |||.                        ||:..|..
  Fly   267 EMGGSREEDEDDDADLELDGEQDEYDYNLQDNDSADAGYDEYEEPKKHLELDDDHLHLDYASDGE 331

  Fly   382 SL------------EKH-------------------------------------------SFYSL 391
            |:            |||                                           ..|::
  Fly   332 SVVKRQGKHKGSAYEKHYQSKLAATTPPQQPPKVTPPGKVTPPSTAAPSAAASAVTLPISQHYAV 396

  Fly   392 SQLKVSARLDCNGHAN--------------------RSHESPDDP----------------LMQC 420
            |...|..|..|||||:                    :..::|..|                .|.|
  Fly   397 SDFAVGGRCKCNGHASECVATVSSGSGTALSDQDDGQDEDTPSAPSLANHFGRSTQMSAKLTMTC 461

  Fly   421 ICQHNTCGAQCEQCCPLFQDRPY-----QMGGECEICQCYGHAESCTYDPFLDK-------GICQ 473
            .|:|||.|.:||:|.|.:.|||:     ....||::|||.|||..|.::..|.|       |:|.
  Fly   462 ACKHNTAGPECERCKPFYFDRPWGRATDNDANECKMCQCNGHARRCRFNLELYKLSGRVSGGVCY 526

  Fly   474 SCSNNTAGIECEFCEMGFYRELDAPLTDP-----CLPCSCNPARSTG-GCQSDGGSCNCLEGFQG 532
            :|.::|.|..|.:|..|:||:...|   |     |..|.|:|..||| .|....|.|.|.||..|
  Fly   527 NCQHDTTGRYCHYCREGYYRDATKP---PNHRKVCKRCDCHPVGSTGKTCNHLSGQCPCKEGVTG 588

  Fly   533 KNCEECAPGY 542
            ..|..||.||
  Fly   589 LTCNRCARGY 598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wbNP_723870.1 Laminin_N 164..396 CDD:278484 60/362 (17%)
EGF_Lam 401..450 CDD:238012 23/90 (26%)
TNFRSF <407..507 CDD:304602 41/153 (27%)
EGF_Lam 505..552 CDD:238012 18/40 (45%)
Laminin_EGF 550..597 CDD:278482
Laminin_B 660..798 CDD:278481
EGF_Lam 851..900 CDD:238012
Laminin_EGF <943..971 CDD:278482
VSP 953..1414 CDD:146106
Laminin_EGF 974..1018 CDD:278482
EGF_Lam 1017..1065 CDD:238012
Laminin_EGF 1065..>1105 CDD:278482
EGF_Lam 1150..1197 CDD:238012
Laminin_EGF 1199..1247 CDD:278482
EGF_Lam 1247..1292 CDD:238012
Laminin_EGF 1294..1342 CDD:278482
Laminin_EGF 1340..1392 CDD:278482
Laminin_B 1486..1611 CDD:278481
EGF_Lam 1669..1716 CDD:238012
Laminin_EGF 1718..1767 CDD:278482
EGF_Lam 1772..1819 CDD:238012
CrfC <1933..2267 CDD:223771
Laminin_II 2277..2400 CDD:283628
LamG 2399..>2492 CDD:304605
Laminin_G_2 2616..2755 CDD:280389
Laminin_G_2 2804..2944 CDD:280389
Laminin_G_2 3038..3169 CDD:280389
LamG 3192..3347 CDD:238058
NetBNP_001162753.1 LamNT 37..261 CDD:214532 48/239 (20%)
EGF_Lam <458..484 CDD:238012 14/26 (54%)
EGF_Lam 498..555 CDD:238012 21/60 (35%)
EGF_Lam 560..608 CDD:238012 18/40 (45%)
NTR_netrin-1_like 661..791 CDD:239634
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C129935914
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000046
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10574
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.