DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: sbr and ssp2

Sequence 1:NP_524660.1 Gene:sbr FlyBaseID:FBgn0003321 Length:672 Species:Drosophila melanogaster
Sequence 2:NP_001287065.1 Gene:ssp2 FlyBaseID:FBgn0036389 Length:982 Species:Drosophila melanogaster

Alignment Length:511 Identity:104/512 (20%)
Similarity:180/512 (35%) Gaps:140/512 (27%)


  Fly   173 NGHLPDGYRLMPRVRSGIPLVAIDDAFKEKMKVTMAKRYN------IQTKALDLSRFHADPD--L 229
            |.:...||....:.|..:.|..|..|..:|...|...|.|      .:|...:..:|..|..  |
  Fly   367 NNNNKAGYTPTLKGRGDMNLSPIVGATPQKPTGTAPGRLNNTFEPVAKTAPFNGEKFVLDTMELL 431

  Fly   230 KQVFCPL---FRQNVMGAAIDIMCDNIPDLEALNLNDNSISSMEAFKGVEKRLPNLKILYLGDNK 291
            :|:..||   :...:......:.|  :.||....:      .|.|.:|.|::..|:         
  Fly   432 EQIEQPLDGTYNLQMSEQHRQMQC--VMDLAEAEV------EMLAQQGDEEQFENM--------- 479

  Fly   292 IPSLAHLVVLRNLSILELVLKNNPCRSRYKDSQQFISEVRRKFPKLVKLDGETLEPQITFDLSEQ 356
               ||.|..:..|:..:|.:            |:.:..::|:|.: .:.:.|..|.::....:|:
  Fly   480 ---LAELGKVNTLNEEQLKM------------QKSLDTIKRRFHR-DEAEAEEREEELQQSAAEK 528

  Fly   357 ---GRLLETKASYLCDVAGAEVVRQFLDQYFRIFDSGNRQALLDAYHEKAMLSISMPSASQAGRL 418
               ..|.::.:|......|.|   :.|.:..|::|..|    |.|.|.....|.|..||      
  Fly   529 VDTPVLNQSHSSSNSSGGGGE---RLLSRRSRLYDDVN----LSAMHGSNGSSTSTNSA------ 580

  Fly   419 NSFWKFNRNLRRLLNGEENRTRNLKYGRLACVSTLDEWPKTQ-----------------HDRRTF 466
             ||....|::.::.....:..          ....:|.||:|                 .||..|
  Fly   581 -SFIVQRRDMPQVEQPAPDPD----------PEPAEEPPKSQVTAEIDPASYKLPERRERDRDRF 634

  Fly   467 TVDLTIYNTSMMVFTVTGLFKELNDETNNPASME------LYDVRHFARTYVVVPQNNG-----F 520
            .   ||..:..|......:...::||   |..:|      :.|||:      ...|..|     .
  Fly   635 K---TIKISKEMRLQPEIIVPCIDDE---PQQLEDEQKQLVEDVRY------EEDQRQGSPPGRL 687

  Fly   521 CIRNETIFITN---------ATHEQVRE----FKRSQHQPAP-GAMPSTSSAVTSPQAGA----A 567
            ..|::|..|:|         .|:::.:|    .:|.|.|.|| .|.|:.:|.:..|::.:    .
  Fly   688 SRRDQTTAISNNADASASNYLTYKKPKEKSLIQRRPQQQEAPLLAEPAPASTLPQPRSLSRPRYI 752

  Fly   568 AGLQGRLNALGVATGPVAILSGDPLAATAPVNSGSAAISTTAVAPGAQDESTKMQM 623
            :||| :...:..||...|.|:..|          :||:.||...|...:...|..|
  Fly   753 SGLQ-KFTTVSKATSAGAGLNATP----------AAAMPTTVTVPANGNGELKSPM 797

Known Domains:


GeneSequenceDomainRegion External IDIdentity
sbrNP_524660.1 Tap-RNA_bind 112..191 CDD:286271 4/18 (22%)
leucine-rich repeat 215..255 CDD:275382 8/45 (18%)
LRR_RI <223..341 CDD:238064 22/123 (18%)
LRR_8 256..315 CDD:290566 11/59 (19%)
LRR_4 256..298 CDD:289563 8/42 (19%)
leucine-rich repeat 256..281 CDD:275382 5/25 (20%)
leucine-rich repeat 282..305 CDD:275382 4/23 (17%)
leucine-rich repeat 306..336 CDD:275382 4/30 (13%)
NTF2 372..531 CDD:238403 38/187 (20%)
Big_3_5 <578..>614 CDD:293246 10/36 (28%)
TAP_C 609..671 CDD:197882 3/16 (19%)
ssp2NP_001287065.1 PHA03247 <676..965 CDD:223021 32/134 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3763
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.