DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: or and APS3

Sequence 1:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_012510.3 Gene:APS3 SGDID:S000003561 Length:194 Species:Saccharomyces cerevisiae

Alignment Length:158 Identity:71/159 (45%)
Similarity:102/159 (64%) Gaps:12/159 (8%)


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRD-DNVCNFL-----------EGG 53
            ||.|:|:||...:|||.|||...|...|:.::::.::|:|:|: |...:||           ...
Yeast     1 MIHAVLIFNKKCQPRLVKFYTPVDLPKQKLLLEQVYELISQRNSDFQSSFLVTPPSLLLSNENNN 65

  Fly    54 SLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHH 118
            ..:...|.::||::||||||.|.||..||||.||||||.|||:||:||..|.||||||:...:..
Yeast    66 DEVNNEDIQIIYKNYATLYFTFIVDDQESELAILDLIQTFVESLDRCFTEVNELDLIFNWQTLES 130

  Fly   119 ILSELVMGGMVLQTNMNDIMARIEEQNK 146
            :|.|:|.||||::||:|.|:|.::|.||
Yeast   131 VLEEIVQGGMVIETNVNRIVASVDELNK 158

Known Domains:


GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 APS2 1..143 CDD:227363 68/154 (44%)
APS3NP_012510.3 APS2 1..172 CDD:227363 71/159 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C75258671
eggNOG 1 0.900 E1_COG5030
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 135 1.000 Inparanoid score I1200
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001310
OrthoInspector 1 1.000 T1136868
orthoMCL 1 0.900 OOG5_128281
Panther 1 1.100 LDO PTHR11753
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R65
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.