DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: or and AT3G50860

Sequence 1:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_190655.2 Gene:AT3G50860 AraportID:AT3G50860 Length:166 Species:Arabidopsis thaliana

Alignment Length:163 Identity:83/164 (51%)
Similarity:113/164 (69%) Gaps:2/164 (1%)


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            ||||:::.|..|||||:|||.|.....||::|:..|.::..|.:||.||||..||. |.|.:|:|
plant     1 MIKAVMMMNTQGKPRLAKFYDYLPVEKQQELIRGVFSVLCSRPENVSNFLEIESLF-GPDSRLVY 64

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            :||||||||...|.||:||.:||||||.||||||||.||||||::|:...:|.:|.|:|.||.||
plant    65 KHYATLYFVLVFDGSENELAMLDLIQVLVETLDKCFSNVCELDIVFNYSKMHAVLDEIVFGGQVL 129

  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVS 163
            :|:..::|..:||.:|:......||..| ::||
plant   130 ETSSAEVMKAVEEISKLEAASNSISLVP-KSVS 161

Known Domains:


GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 APS2 1..143 CDD:227363 76/142 (54%)
AT3G50860NP_190655.2 APS2 1..151 CDD:227363 78/151 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H100592
Inparanoid 1 1.050 168 1.000 Inparanoid score I1520
OMA 1 1.010
OrthoDB 1 1.010 D1458249at2759
OrthoInspector 1 1.000 T193599
orthoMCL 1 0.900 OOG5_128281
Panther 1 1.100 LDO PTHR11753
Phylome 1 0.910 0.667 Consistency score
98.980

Return to query results.
Submit another query.