DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: or and Ap3s2

Sequence 1:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001108511.1 Gene:Ap3s2 RGDID:1586888 Length:193 Species:Rattus norvegicus

Alignment Length:193 Identity:147/194 (76%)
Similarity:169/194 (87%) Gaps:7/194 (4%)


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            ||:|||||||||||||.:|||.|.|.:||||::|||.||.|||||:|||||||||||||||||||
  Rat     1 MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIY 65

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            |||||||||||||||||||||||||||||||||||||||||||||||.|.||:||.|:|||||||
  Rat    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVL 130

  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQ-----QIKD--IKLPDLPQAI 186
            :||||:|:|:||.||::.|.|.|:||||||||||||::|:|:     .|.|  ||:|:|.|.:
  Rat   131 ETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV 193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 APS2 1..143 CDD:227363 121/142 (85%)
Ap3s2NP_001108511.1 AP3_sigma 1..146 CDD:341438 123/145 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C75247493
eggNOG 1 0.900 E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H100592
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1458249at2759
OrthoFinder 1 1.000 FOG0001310
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11753
Phylome 1 0.910 0.800 Consistency score
TreeFam 1 0.960
98.820

Return to query results.
Submit another query.