DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and Ap3s2

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001108511.1 Gene:Ap3s2 / 683402 RGDID:1586888 Length:193 Species:Rattus norvegicus


Alignment Length:193 Identity:147/193 - (76%)
Similarity:169/193 - (87%) Gaps:7/193 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            ||:|||||||||||||.:|||.|.|.:||||::|||.||.|||||:|||||||||||||||||||
  Rat     1 MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIY 65

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            |||||||||||||||||||||||||||||||||||||||||||||||.|.||:||.|:|||||||
  Rat    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVL 130

  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQ-----QIKD--IKLPDLPQAI 186
            :||||:|:|:||.||::.|.|.|:||||||||||||::|:|:     .|.|  ||:|:|.|.:
  Rat   131 ETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 122/144 (85%)
Ap3s2NP_001108511.1 AP3_sigma 1..146 CDD:341438 122/144 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341903
Domainoid 1 1.000 44 1.000 Domainoid score I12000
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H100592
Inparanoid 1 1.050 265 1.000 Inparanoid score I2986
OMA 1 1.010 - - QHG53551
OrthoDB 1 1.010 - - D1458249at2759
OrthoFinder 1 1.000 - - FOG0002758
OrthoInspector 1 1.000 - - oto95568
orthoMCL 1 0.900 - - OOG6_102376
Panther 1 1.100 - - LDO PTHR11753
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1844
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.