DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: or and ap3s2

Sequence 1:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001011184.1 Gene:ap3s2 XenbaseID:XB-GENE-5734699 Length:193 Species:Xenopus tropicalis

Alignment Length:182 Identity:141/183 (77%)
Similarity:163/183 (89%) Gaps:0/183 (0%)


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            |||||||||||||||..:|||:|.|..||||::|||.||||||||||||||||||||||||||||
 Frog     1 MIKAILVFNNHGKPRFLRFYQHFPEDTQQQIVRETFHLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            ||||||||||||||||||||||||||||||||||||||||||||||:.|.||:||.|:|||||||
 Frog    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFNVDKVHYILHEMVMGGMVL 130

  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQQIKDIKLPDL 182
            :|||::::.::|.|:|:.|.|||.||||||||||:|:||:|...::|.:.||
 Frog   131 ETNMSEVITQVEAQSKLEKSEAGFSAAPARAVSAMKNMNLPDLPRNINIGDL 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 APS2 1..143 CDD:227363 118/142 (83%)
ap3s2NP_001011184.1 APS2 1..152 CDD:227363 122/151 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C75246327
eggNOG 1 0.900 E1_COG5030
Hieranoid 1 1.000
Homologene 1 1.000 H100592
Inparanoid 1 1.050 294 1.000 Inparanoid score I2569
OMA 1 1.010
OrthoDB 1 1.010 D1458249at2759
OrthoFinder 1 1.000 FOG0001310
OrthoInspector 1 1.000 T602124
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R65
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.