DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: or and ap3s1

Sequence 1:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001005964.1 Gene:ap3s1 ZFINID:ZDB-GENE-041010-38 Length:193 Species:Danio rerio

Alignment Length:190 Identity:143/191 (75%)
Similarity:167/191 (87%) Gaps:7/191 (4%)


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            ||||||:|||||||||||||:::.|..:||||:|||.||||||:|||||||||.||||||.||||
Zfish     1 MIKAILIFNNHGKPRLSKFYEHYTEDTEQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIY 65

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            |||||||||||||||||||||||||||||||||||||||||||||||.|.||:||:|:|||||||
Zfish    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHNILAEMVMGGMVL 130

  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQQIKD-------IKLPDLP 183
            :|||::|:.:.|.|:|:.|.||||:.||||||||||:||:|:..|:       ||:|:||
Zfish   131 ETNMSEIITQAEAQSKMEKSEAGIAGAPARAVSAVKNMNLPEMPKNINIGDISIKVPNLP 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 APS2 1..143 CDD:227363 117/142 (82%)
ap3s1NP_001005964.1 APS2 1..152 CDD:227363 121/151 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1458249at2759
OrthoFinder 1 1.000 FOG0001310
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.