DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: or and arpin

Sequence 1:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001004898.1 Gene:arpin XenbaseID:XB-GENE-941490 Length:226 Species:Xenopus tropicalis

Alignment Length:37 Identity:10/38 (26%)
Similarity:15/38 (39%) Gaps:13/38 (34%)


  Fly    77 VDSSESELG-------------ILDLIQVFVETLDKC 100
            |:.:|.|||             :..|.:|...|:.||
 Frog   147 VEKTELELGEQLRVKTMGDSPFVFSLAKVDSGTVTKC 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 APS2 1..143 CDD:227363 10/38 (26%)
arpinNP_001004898.1 UPF0552 1..225 CDD:313736 10/38 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1458249at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.