DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: or and ap3s2

Sequence 1:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001002539.1 Gene:ap3s2 ZFINID:ZDB-GENE-040718-274 Length:192 Species:Danio rerio

Alignment Length:182 Identity:146/183 (80%)
Similarity:167/183 (91%) Gaps:0/183 (0%)


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            ||||||:|||||||||.:|||||.|.:|||||:|||.||||||||||||||||||||||||||||
Zfish     1 MIKAILIFNNHGKPRLIRFYQYFAEDMQQQIIRETFHLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            |||||||||||||||||||||||||||||||||||||||||||||||.|.||:||.|:|||||||
Zfish    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVL 130

  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQQIKDIKLPDL 182
            :||||:|:|::|.||::.|.|.|:||||||||||||:||:|:..::|.:.|:
Zfish   131 ETNMNEIVAQVELQNRMEKSEGGLSAAPARAVSAVKNMNLPEIPRNINIGDI 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 APS2 1..143 CDD:227363 124/142 (87%)
ap3s2NP_001002539.1 AP3_sigma 1..146 CDD:341438 126/145 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C75248865
eggNOG 1 0.900 E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H100592
Inparanoid 1 1.050 303 1.000 Inparanoid score I2600
OMA 1 1.010
OrthoDB 1 1.010 D1458249at2759
OrthoFinder 1 1.000 FOG0001310
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128281
Panther 1 1.100 LDO PTHR11753
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R65
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.