DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: or and Ap1s1

Sequence 1:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_006249241.1 Gene:Ap1s1 RGDID:1305911 Length:191 Species:Rattus norvegicus

Alignment Length:178 Identity:59/179 (33%)
Similarity:99/179 (55%) Gaps:24/179 (13%)


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            |::.:|:|:..||.||.|:|....:..::::::|..|:|..|...:|:|||      ..|.|::|
  Rat     1 MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLE------WRDLKVVY 59

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            :.||:|||...::..::||..|:||..:||.|||.|.:|||||:||:.:..:.||.|.:|||.|.
  Rat    60 KRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQ 124

  Fly   131 QTNMNDIMARI------------------EEQNKIVKQEAGISAAPAR 160
            .|:...::..|                  ||::..|:.::...|.|||
  Rat   125 DTSKKSVLKAIEQADLLQEVRARDSEEEEEEEDYCVRGDSPPLAHPAR 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 APS2 1..143 CDD:227363 53/160 (33%)
Ap1s1XP_006249241.1 Clat_adaptor_s 1..142 CDD:250451 52/147 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.