DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: or and Ap3s1

Sequence 1:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:XP_006254755.1 Gene:Ap3s1 RGDID:1311115 Length:209 Species:Rattus norvegicus

Alignment Length:206 Identity:147/207 (71%)
Similarity:167/207 (81%) Gaps:23/207 (11%)


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            ||||||:||||||||||||||.:.|..|||||:|||.||||||:|||||||||.||||||.||||
  Rat     1 MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIY 65

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            |||||||||||||||||||||||||||||||||||||||||||||||.|.||:||:|:|||||||
  Rat    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVL 130

  Fly   131 QTNMNDIMARIEEQNKIVKQE----------------AGISAAPARAVSAVKSMNIPQ-----QI 174
            :||||:|:.:|:.|||:.|.|                ||::.||||||||||:||:|:     .|
  Rat   131 ETNMNEIVTQIDAQNKLEKSEQIVYTGLFCISQDFSQAGLAGAPARAVSAVKNMNLPEIPRNINI 195

  Fly   175 KD--IKLPDLP 183
            .|  ||:|:||
  Rat   196 GDISIKVPNLP 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 APS2 1..143 CDD:227363 120/142 (85%)
Ap3s1XP_006254755.1 AP3_sigma 1..146 CDD:341438 122/145 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C75246120
eggNOG 1 0.900 E1_COG5030
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I2988
OMA 1 1.010
OrthoDB 1 1.010 D1458249at2759
OrthoFinder 1 1.000 FOG0001310
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11753
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.