| Sequence 1: | NP_536793.1 | Gene: | or / 43943 | FlyBaseID: | FBgn0003008 | Length: | 191 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006254755.1 | Gene: | Ap3s1 / 302290 | RGDID: | 1311115 | Length: | 209 | Species: | Rattus norvegicus | 
| Alignment Length: | 206 | Identity: | 147/206 - (71%) | 
|---|---|---|---|
| Similarity: | 167/206 - (81%) | Gaps: | 23/206 - (11%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65 
  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130 
  Fly   131 QTNMNDIMARIEEQNKIVKQE----------------AGISAAPARAVSAVKSMNIPQ-----QI 174 
  Fly   175 KD--IKLPDLP 183  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| or | NP_536793.1 | AP3_sigma | 1..146 | CDD:341438 | 121/144 (84%) | 
| Ap3s1 | XP_006254755.1 | AP3_sigma | 1..146 | CDD:341438 | 121/144 (84%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C166341904 | |
| Domainoid | 1 | 1.000 | 255 | 1.000 | Domainoid score | I1966 | 
| eggNOG | 1 | 0.900 | - | - | E1_COG5030 | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG53551 | |
| OrthoDB | 1 | 1.010 | - | - | D1458249at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0002758 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 1 | 0.900 | - | - | OOG6_102376 | |
| Panther | 1 | 1.100 | - | - | O | PTHR11753 | 
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X1844 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 12 | 11.760 | |||||