DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: or and aps3

Sequence 1:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_593212.1 Gene:aps3 PomBaseID:SPAC30D11.05 Length:165 Species:Schizosaccharomyces pombe

Alignment Length:149 Identity:87/150 (58%)
Similarity:112/150 (75%) Gaps:4/150 (3%)


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            ||.|:.:|||.|||||:|||...|||:||::|.:.:..||.|....||||| .:||.|.: ::||
pombe     1 MIYAVFIFNNKGKPRLTKFYTPIDESIQQKLIGDIYAAVSTRPPTACNFLE-SNLIAGKN-RIIY 63

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            |.||||||||.||..|||||||||||||||.||:||.|||||||:|....:|.||:|:|.||:||
pombe    64 RQYATLYFVFVVDEGESELGILDLIQVFVEALDRCFNNVCELDLVFKFQEIHAILAEVVSGGLVL 128

  Fly   131 QTNMNDIMARIEEQNKIVK 149
            :||:|:|:  :..||::.|
pombe   129 ETNLNEIV--LAAQNQMPK 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 APS2 1..143 CDD:227363 84/142 (59%)
aps3NP_593212.1 APS2 1..151 CDD:227363 87/150 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I1160
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001310
OrthoInspector 1 1.000 T1125878
orthoMCL 1 0.900 OOG5_128281
Panther 1 1.100 LDO PTHR11753
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R65
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.