DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and aps2

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_596138.1 Gene:aps2 / 2541086 PomBaseID:SPBC685.04c Length:143 Species:Schizosaccharomyces pombe


Alignment Length:148 Identity:67/148 - (45%)
Similarity:95/148 - (64%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNV-CNFLEGGSLIGGSDYKLI 64
            ||:.||:.|.|||.||||:|..||:..:.::.....||:|:|:... .||||      ..:.||:
pombe     1 MIQFILIQNRHGKNRLSKYYVPFDDDEKVRLKARIHQLISQRNQKFQANFLE------WENSKLV 59

  Fly    65 YRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMV 129
            ||.||.|||.|||||::::|.||::|..|||.||..|.|||||||||:...|..||.|:::||.:
pombe    60 YRRYAGLYFCFCVDSTDNDLAILEMIHFFVEILDSFFGNVCELDLIFNFYKVSAILDEIILGGEI 124

  Fly   130 LQTNMNDIMARIEEQNKI 147
            .::|...::.|||...|:
pombe   125 GESNKKSVLERIEALEKL 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 66/145 (46%)
aps2NP_596138.1 APS2 1..143 CDD:227363 67/148 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.