powered by:
                   
 
    
    
             
          
            Protein Alignment or and aps2
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_536793.1 | Gene: | or / 43943 | FlyBaseID: | FBgn0003008 | Length: | 191 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_596138.1 | Gene: | aps2 / 2541086 | PomBaseID: | SPBC685.04c | Length: | 143 | Species: | Schizosaccharomyces pombe | 
        
        
        
          
            | Alignment Length: | 148 | Identity: | 67/148 - (45%) | 
          
            | Similarity: | 95/148 -  (64%) | Gaps: | 7/148 - (4%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNV-CNFLEGGSLIGGSDYKLI 64||:.||:.|.|||.||||:|..||:..:.::.....||:|:|:... .||||      ..:.||:
 pombe     1 MIQFILIQNRHGKNRLSKYYVPFDDDEKVRLKARIHQLISQRNQKFQANFLE------WENSKLV 59
 
 
  Fly    65 YRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMV 129||.||.|||.|||||::::|.||::|..|||.||..|.|||||||||:...|..||.|:::||.:
 pombe    60 YRRYAGLYFCFCVDSTDNDLAILEMIHFFVEILDSFFGNVCELDLIFNFYKVSAILDEIILGGEI 124
 
 
  Fly   130 LQTNMNDIMARIEEQNKI 147.::|...::.|||...|:
 pombe   125 GESNKKSVLERIEALEKL 142
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_COG5030 | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 1 | 1.010 | - | - |  | QHG53551 | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 3 | 2.820 |  | 
        
      
           
             Return to query results.
             Submit another query.