DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: or and aps-3

Sequence 1:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_740780.1 Gene:aps-3 WormBaseID:WBGene00000165 Length:192 Species:Caenorhabditis elegans

Alignment Length:183 Identity:153/184 (83%)
Similarity:171/184 (93%) Gaps:0/184 (0%)


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            |||||||.||||||||.||||::.|..||||::||||||||||||||||||||:||.|:||:|||
 Worm     1 MIKAILVINNHGKPRLLKFYQHYPEEKQQQIVRETFQLVSKRDDNVCNFLEGGTLIDGNDYRLIY 65

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            ||||||||:||||||||||||||||||||||||:|||||||||||||.|.|||||.|:|||||||
 Worm    66 RHYATLYFIFCVDSSESELGILDLIQVFVETLDRCFENVCELDLIFHVDRVHHILGEIVMGGMVL 130

  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQQIKDIKLPDLP 183
            :||||:|:.||:||:||.||||||:|||||||||||:|||.||:|||||||||
 Worm   131 ETNMNEILQRIQEQDKIQKQEAGITAAPARAVSAVKNMNISQQLKDIKLPDLP 183

Known Domains:


GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 APS2 1..143 CDD:227363 118/142 (83%)
aps-3NP_740780.1 APS2 1..146 CDD:227363 120/145 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C75234583
eggNOG 1 0.900 E1_COG5030
Hieranoid 1 1.000
Homologene 1 1.000 H100592
Inparanoid 1 1.050 318 1.000 Inparanoid score I1490
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1458249at2759
OrthoFinder 1 1.000 FOG0001310
OrthoInspector 1 1.000 T477568
orthoMCL 1 0.900 OOG5_128281
Panther 1 1.100 LDO PTHR11753
Phylome 1 0.910 0.951 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R65
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.