DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment or and Ap4s1

DIOPT Version :9

Sequence 1:NP_536793.1 Gene:or / 43943 FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001316627.1 Gene:Ap4s1 / 11782 MGIID:1337065 Length:169 Species:Mus musculus


Alignment Length:117 Identity:44/117 - (37%)
Similarity:63/117 - (53%) Gaps:6/117 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            |||..|:.|..|:.||||:|::.|.:.:..:..|..:....|....|:|:|      ..|:||||
Mouse     1 MIKFFLMVNKQGQTRLSKYYEHVDINKRALLETEVSKSCLSRSSEQCSFIE------YKDFKLIY 59

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVH 117
            |.||.|:.|..|:.:|:|:.|.:.|..|||.||..|..|.|||:.|.....|
Mouse    60 RQYAALFVVVGVNDTENEMAIYEFIHNFVEVLDGYFSRVSELDVSFFCTFFH 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 AP3_sigma 1..146 CDD:341438 44/117 (38%)
Ap4s1NP_001316627.1 longin-like 3..>105 CDD:365781 40/107 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5030
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53551
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.