DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: or and Ap3s1

Sequence 1:NP_536793.1 Gene:or FlyBaseID:FBgn0003008 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_033811.1 Gene:Ap3s1 MGIID:1337062 Length:193 Species:Mus musculus

Alignment Length:190 Identity:147/191 (77%)
Similarity:167/191 (87%) Gaps:7/191 (4%)


  Fly     1 MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSDYKLIY 65
            ||||||:||||||||||||||.:.|..|||||:|||.||||||:|||||||||.||||||.||||
Mouse     1 MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIY 65

  Fly    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSELVMGGMVL 130
            |||||||||||||||||||||||||||||||||||||||||||||||.|.||:||:|:|||||||
Mouse    66 RHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHNILAEMVMGGMVL 130

  Fly   131 QTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQ-----QIKD--IKLPDLP 183
            :||||:|:.:|:.|||:.|.|||::.||||||||||:||:|:     .|.|  ||:|:||
Mouse   131 ETNMNEIVTQIDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLP 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
orNP_536793.1 APS2 1..143 CDD:227363 120/142 (85%)
Ap3s1NP_033811.1 AP3_sigma 1..146 CDD:341438 122/145 (84%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C75248217
eggNOG 1 0.900 E1_COG5030
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 297 1.000 Inparanoid score I2693
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1458249at2759
OrthoFinder 1 1.000 FOG0001310
OrthoInspector 1 1.000 T617088
orthoMCL 1 0.900 OOG5_128281
Panther 1 1.100 O PTHR11753
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R65
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.