powered by:
Protein Alignment or and AP2S1
DIOPT Version :9
| Sequence 1: | NP_536793.1 |
Gene: | or / 43943 |
FlyBaseID: | FBgn0003008 |
Length: | 191 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_011524725.1 |
Gene: | AP2S1 / 1175 |
HGNCID: | 565 |
Length: | 172 |
Species: | Homo sapiens |
| Alignment Length: | 157 |
Identity: | 58/157 - (36%) |
| Similarity: | 93/157 - (59%) |
Gaps: | 18/157 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 2 IKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLE--------GGSLIGG 58
|:.||:.|..||.||:|:|..||:..:|::|:|...:|:.||....||:| ..|::..
Human 18 IRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEVLAISVADSLSVLQF 82
Fly 59 SDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHILSEL 123
.::|:|||.||.|||..|||.:::.|..|:.|..|||.|::.|.|||||||:|:...|:.::.|:
Human 83 RNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEM 147
Fly 124 VMGGMVLQTNMNDIMARIEEQNKIVKQ 150
.:.|.:.:|: |.|::||
Human 148 FLAGEIRETS----------QTKVLKQ 164
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5030 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
1 |
1.010 |
- |
- |
|
QHG53551 |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
| User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.