DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and HTR3B

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_006019.1 Gene:HTR3B HGNCID:5298 Length:441 Species:Homo sapiens

Alignment Length:342 Identity:67/343 (20%)
Similarity:119/343 (35%) Gaps:97/343 (28%)


  Fly   202 YGSEIAPI---VKEETKTEKLLSH--LNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRM 261
            |..|:.|:   .|..|....|..|  |::.|||                         .:|:|.:
Human    43 YHKEVRPVYNWTKATTVYLDLFVHAILDVDAEN-------------------------QILKTSV 82

  Fly   262 HMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELM--VYANGSI 324
            .....|.|..|.|....|..:.....|...||.|.: ::|..:.     ::.|..:  ||.|.|.
Human    83 WYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDI-IINEFVD-----IERYPDLPYVYVNSSG 141

  Fly   325 TLYAQN---LQLASWCVDSARNWPSERVTC------------DIELG-LNGQEGQENVALIYDDQ 373
            |:  :|   :|:.|.|......:|.:...|            |::|. |...|.      |..|:
Human   142 TI--ENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPED------IQHDK 198

  Fly   374 RKPIAPNEHVNTPSGWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVA-IEFTLQRNRSFYMTVF 437
            :..:..:|       |....:|            :...::|...|..| |:|.:...|  :..|:
Human   199 KAFLNDSE-------WELLSVS------------STYSILQSSAGGFAQIQFNVVMRR--HPLVY 242

  Fly   438 YLPLIACQMFLIL----SFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMM 498
            .:.|:...:||:|    ||.|....|:.::....::..:.:.   |....:.||      :.:..
Human   243 VVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVF---RVNMSNQVP------RSVGS 298

  Fly   499 TTTYCYILHICIIWLDL 515
            |....:...||:.:|.|
Human   299 TPLIGHFFTICMAFLVL 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 45/238 (19%)
HTR3BNP_006019.1 LIC 8..435 CDD:273305 67/343 (20%)
Neur_chan_LBD 33..239 CDD:280998 50/256 (20%)
Neur_chan_memb 246..>328 CDD:280999 16/80 (20%)
HA-stretch 381..413
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.