DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NtR and CHRNA6

DIOPT Version :9

Sequence 1:NP_651958.2 Gene:NtR / 43935 FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_004189.1 Gene:CHRNA6 / 8973 HGNCID:15963 Length:494 Species:Homo sapiens


Alignment Length:368 Identity:79/368 - (21%)
Similarity:147/368 - (39%) Gaps:44/368 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 WFYDCGFDGYGSEIAPIVKEETKTEKLLSHLN---IQAENASMPANLSSISFHFQ---TRSLAYE 251
            |.  |.|..:.........||....||.||.|   ...||.|.|     ::.||:   |:....:
Human    17 WL--CVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDP-----VTVHFEVAITQLANVD 74

  Fly   252 QTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYEL 316
            :.:.:::|.:.:...|.|.:|.|.|.::..:|:...|..:||||.:.:.|.|:... ||....:.
Human    75 EVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDF-QVEGKTKA 138

  Fly   317 MVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNE 381
            ::..||.|| :.......|.|......:|.:...|.::.|....:..|...||...:        
Human   139 LLKYNGMIT-WTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSK-------- 194

  Fly   382 HVNTPSGWSFTQMSVVLVENDSQR-----RYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPL 441
             |:....|..::..::    |:..     :||   ..:::..|:...|.::|...||.....:|.
Human   195 -VDMNDFWENSEWEII----DASGYKHDIKYN---CCEEIYTDITYSFYIRRLPMFYTINLIIPC 251

  Fly   442 IACQMFLILSFVLRST--RRSSLILIALLIAAWGLMYMTR-YASPHYVPPMMTAYKVIMMTTTYC 503
            :......:|.|.|.|.  .:.:|.:..||.....|:.:|. ..|...|.|::..|.:..|.....
Human   252 LFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTL 316

  Fly   504 YILHICIIWLDLY---PPRSKAPGWLVRVINSNVLRCILGLRF 543
            .|: :.:..|:::   |.....|.| |:.:...:|..:|.:|:
Human   317 SIV-VTVFVLNIHYRTPTTHTMPRW-VKTVFLKLLPQVLLMRW 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 49/227 (22%)
CHRNA6NP_004189.1 Neur_chan_LBD 34..484 CDD:332142 76/349 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.