DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and glra4a

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_005169655.1 Gene:glra4a ZFINID:ZDB-GENE-010410-3 Length:457 Species:Danio rerio

Alignment Length:365 Identity:79/366 (22%)
Similarity:135/366 (37%) Gaps:107/366 (29%)


  Fly   175 PLVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKT---------------EKLLSHLN 224
            |.||..|...||      :|:..||...||     .|||.|:               :||:...:
Zfish     3 PQVIRILYVLSF------FFFQGGFIRLGS-----CKEEIKSSSRPAQKPMSPSDFLDKLMGRTS 56

  Fly   225 -----IQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMM--HWRDSRLVWKPEDFGSL 282
                 |:......|.|::...|.....|:    |.:.:..|:::.:  .|.|.||.:.       
Zfish    57 GYDARIRPNFKGPPVNVTCNIFINSFGSI----TETTMDYRLNVFLRQQWNDPRLAYS------- 110

  Fly   283 ESFEHPDL----------RIWKPHMNVLNGALQSMGQVLQSYELM-VYANGSITLYAQNLQLASW 336
               |:||.          .||||.:...|....:..:|....:|: ::.||:: ||:..|.|...
Zfish   111 ---EYPDASLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFQNGNV-LYSIRLTLILS 171

  Fly   337 CVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQMSVVLVEN 401
            |....:|:|.:..||.::|...|....:.:.....|  .|:...:.:..|       ..|:..|.
Zfish   172 CPMDLKNFPMDIQTCTMQLESFGYTMNDLIFEWLSD--NPVQVADDLTLP-------QFVLKEEK 227

  Fly   402 D---SQRRYNPKGMMQKMTGD---VAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLRSTRRS 460
            |   ..:.||        ||.   :.::|.|:|...:|:...|:|                    
Zfish   228 DLGYCTKHYN--------TGKFTCIEVKFHLERQMGYYLIQMYIP-------------------- 264

  Fly   461 SLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTT 500
            ||:::   |.:|...::...|:|..|...:|.  |:.|||
Zfish   265 SLLIV---ILSWVSFWINMDAAPARVGLGITT--VLTMTT 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 6/16 (38%)
Neur_chan_LBD 212..429 CDD:280998 52/256 (20%)
glra4aXP_005169655.1 LIC 27..445 CDD:273305 68/331 (21%)
Neur_chan_LBD 48..254 CDD:280998 49/238 (21%)
Neur_chan_memb 261..442 CDD:280999 14/65 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.