DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and glrba

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_571856.1 Gene:glrba ZFINID:ZDB-GENE-010410-2 Length:498 Species:Danio rerio

Alignment Length:293 Identity:59/294 (20%)
Similarity:112/294 (38%) Gaps:53/294 (18%)


  Fly   211 KEETKTEKLLSHLNIQAENAS-MPAN-----LSSISFHFQTR--------------SLAYEQTSS 255
            |:..|.::::....:.||:.. :|||     |:.:...:.:|              ::......|
Zfish    29 KKGKKGKQVICPSQLSAEDLDRVPANSTSNILNRLLMTYDSRIRPNFKGIPVEDKVNIFINSFGS 93

  Fly   256 LLQTRM------HMMMHWRDSRLVWKPEDFGSLESFEHPDL--RIWKPHMNVLNGALQSMGQVLQ 312
            :.:|.|      .:...|.|.|| ..|.||.|......|.:  .:|||.:...|....:...|.|
Zfish    94 IQETTMDYRVNIFLRQRWNDPRL-RLPTDFKSDALTVDPKMFQCLWKPDLFFANEKNANFHDVTQ 157

  Fly   313 -SYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKP 376
             :..|.::.||.: |.:..|.:...|..:.:.:|.:...|.::|...|...::.|.:.....  |
Zfish   158 ENILLFIFRNGDV-LISMRLSVTLSCPLALQLFPMDTQYCKMQLESFGYTTKDLVFMWQSGD--P 219

  Fly   377 IAPNEHVNTPSGWSFTQMSVVLVENDSQR---RYNPKGMMQKMTG---DVAIEFTLQRNRSFYMT 435
            :..:|              :.|.:.|.::   :|.........||   .|.:.|||:|...|||.
Zfish   220 VQMDE--------------IALPQFDVKQEDIKYANCTKFYPGTGYYTCVEVIFTLRRQVGFYMM 270

  Fly   436 VFYLPLIACQMFLILSFVLRSTRRSSLILIALL 468
            ..|.|.:...:...|||.:.....::.:.:.:|
Zfish   271 GVYAPTLLIVVLSWLSFWINPDASAARVPLGIL 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 49/252 (19%)
glrbaNP_571856.1 LIC 52..497 CDD:273305 55/271 (20%)
Neur_chan_LBD 59..265 CDD:280998 43/224 (19%)
Neur_chan_memb 272..494 CDD:280999 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.