DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrna6

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_476532.1 Gene:Chrna6 RGDID:69281 Length:493 Species:Rattus norvegicus

Alignment Length:390 Identity:87/391 (22%)
Similarity:154/391 (39%) Gaps:45/391 (12%)


  Fly   188 SNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLN---IQAENASMPANLSSISFHFQ---TR 246
            |....|.  |||..:.......|.||.....|.:|.|   ...||.|.|     ::.||:   |:
  Rat    12 SGLCLWI--CGFLAFFKGSRGCVSEEQLFHTLFAHYNRFIRPVENVSDP-----VTVHFELAITQ 69

  Fly   247 SLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVL 311
            ....::.:.:::|.:.:...|:|.||.|.|.::..:|:...|...||||.:.:.|.|:... ||.
  Rat    70 LANVDEVNQIMETNLWLRHVWKDYRLCWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDF-QVE 133

  Fly   312 QSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKP 376
            ...:.::..:|.|| :.......|.|......:|.:...|.::.|....:..|...||...:   
  Rat   134 GKTKALLKYDGVIT-WTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSK--- 194

  Fly   377 IAPNEHVNTPSGWSFTQMSVVLVENDSQR-----RYNPKGMMQKMTGDVAIEFTLQRNRSFYMTV 436
                  |:....|..::..:|    |:..     :||   ..:::..|:...|.::|...||...
  Rat   195 ------VDMNDFWENSEWEIV----DASGYKHDIKYN---CCEEIYTDITYSFYIRRLPMFYTIN 246

  Fly   437 FYLPLIACQMFLILSFVLRST--RRSSLILIALLIAAWGLMYMTR-YASPHYVPPMMTAYKVIMM 498
            ..:|.:......:|.|.|.|.  .:.:|.:..||.....|:.:|. ..|...|.|::..|.:..|
  Rat   247 LIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTM 311

  Fly   499 TTTYCYILHICIIWLDLY---PPRSKAPGWLVRVINSNVLRCILGLRFS-DSTDYCDIQENPWHH 559
            ......|: :.:..|:::   |.....|.| |:.:...|...||.:|.. |.|...|..::|..|
  Rat   312 IFVTLSIV-VTVFVLNIHYRTPATHTMPKW-VKTMFLQVFPSILMMRRPLDKTKEMDGVKDPKTH 374

  Fly   560  559
              Rat   375  374

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 1/3 (33%)
Neur_chan_LBD 212..429 CDD:280998 49/228 (21%)
Chrna6NP_476532.1 LIC 34..483 CDD:273305 81/367 (22%)
Neur_chan_LBD 34..240 CDD:280998 49/229 (21%)
Neur_chan_memb 247..482 CDD:280999 30/131 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.