DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and GLRA3

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_006520.2 Gene:GLRA3 HGNCID:4328 Length:464 Species:Homo sapiens

Alignment Length:305 Identity:69/306 (23%)
Similarity:122/306 (40%) Gaps:67/306 (22%)


  Fly   201 GYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMM 265
            ||.:.|.|               |.:....::..|:...||    .|:|  :|:...:..:.:..
Human    56 GYDARIRP---------------NFKGPPVNVTCNIFINSF----GSIA--ETTMDYRVNIFLRQ 99

  Fly   266 HWRDSRLVWK--PEDFGSLESFEHPDL--RIWKPHMNVLNGALQSMGQVLQSYELM-VYANGSIT 325
            .|.|.||.:.  |:|...|:    |.:  .||||.:...|....:..:|....:|: ::.||:: 
Human   100 KWNDPRLAYSEYPDDSLDLD----PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNV- 159

  Fly   326 LYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWS 390
            ||:..|.|...|....:|:|.:..||.::|...|....:   ||::.|.:  ||   |....|.:
Human   160 LYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMND---LIFEWQDE--AP---VQVAEGLT 216

  Fly   391 FTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVLR 455
            ..|.   |::.:...||..|.........:.:.|.|:|...:|:...|:|               
Human   217 LPQF---LLKEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIP--------------- 263

  Fly   456 STRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTT 500
                 ||:::   |.:|...::...|:|..|...:|.  |:.|||
Human   264 -----SLLIV---ILSWVSFWINMDAAPARVALGITT--VLTMTT 298

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 50/222 (23%)
GLRA3NP_006520.2 LIC 12..451 CDD:273305 69/306 (23%)
Strychnine-binding. {ECO:0000269|PubMed:26416729} 235..240 0/5 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.