DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and LOC798522

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_001338964.6 Gene:LOC798522 ID: Length:488 Species:Danio rerio

Alignment Length:327 Identity:72/328 (22%)
Similarity:117/328 (36%) Gaps:57/328 (17%)


  Fly   200 DGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMM 264
            :.|.|.:.|:    ..|:|.|        |.::...||.|.        ..::.:.:|...:.:.
Zfish    39 EDYSSALRPV----DDTDKSL--------NVTLQVTLSQIK--------DMDERNQVLIAYLWIR 83

  Fly   265 MHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQ 329
            ..|.|:.|.|..||:..||....|...||:|.:.:.|.|.......:.:..::.| .|.||..|.
Zfish    84 QVWHDAHLKWSKEDYDGLEVIRIPSSLIWRPDLVLYNKADDDFSGPVDTNVVLRY-TGEITWDAP 147

  Fly   330 NLQLASWCVDSARNWPSERVTCDIELG---LNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSF 391
            .:..:| ||.....:|.:...|::..|   .||.:....:..:..|....:   |:|.    |..
Zfish   148 AITKSS-CVVDVSYFPFDSQQCNLTFGSWTYNGNQVDIAMGSVSGDLSDFV---ENVE----WEC 204

  Fly   392 TQM----SVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSF 452
            ..|    :|::.           |.......|:.....|||..|||:....||.........|||
Zfish   205 HGMPATKNVIMY-----------GCCSDPYPDITYTVLLQRRSSFYIINLLLPCFLISFLAPLSF 258

  Fly   453 VL--RSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMT--------TTYCYILH 507
            .|  .|..:.||.:..||......|.:.....|....|::..|.:..||        |.:...:|
Zfish   259 YLPADSGEKVSLGVTVLLALTVFQMMVAESMPPSESVPLIAKYYIATMTMITASTALTIFIMNIH 323

  Fly   508 IC 509
            .|
Zfish   324 FC 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 46/224 (21%)
LOC798522XP_001338964.6 Neur_chan_LBD 32..477 CDD:332142 72/328 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.