DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrna1

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_077811.1 Gene:Chrna1 RGDID:69277 Length:457 Species:Rattus norvegicus

Alignment Length:459 Identity:84/460 (18%)
Similarity:157/460 (34%) Gaps:151/460 (33%)


  Fly   199 FDGYGSEIAPI-----VKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQ 258
            |..|.|.:.|:     :.:.|...:|:..:|:                         ::.:.::.
  Rat    32 FKDYSSVVRPVGDHREIVQVTVGLQLIQLINV-------------------------DEVNQIVT 71

  Fly   259 TRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNG-----ALQSMGQVLQSYELMV 318
            |.:.:...|.|..|.|.|:|:|.::....|..:||:|.:.:.|.     |:....:||..|    
  Rat    72 TNVRLKQQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDVVLYNNADGDFAIVKFTKVLLDY---- 132

  Fly   319 YANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEH- 382
              .|.|| :.......|:|.....::|.:...|.::||....:|  :|..|..:..:|...|.. 
  Rat   133 --TGHIT-WTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDG--SVVAINPESDQPDLSNFME 192

  Fly   383 -----VNTPSGWS---------------------FTQMSVVLVEN-----------DSQRRYNPK 410
                 :....||.                     ..::.:..:.|           .|...|.|.
  Rat   193 SGEWVIKEARGWKHWVFYSCCPNTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTSLVFYLPT 257

  Fly   411 GMMQKMTGDVAIEFTLQRNRSFYMTVFYL-------------PLIACQMFLILSFVLRSTRRSSL 462
            ...:|||..:::..:|        |||.|             |||...|...:.||:     :|:
  Rat   258 DSGEKMTLSISVLLSL--------TVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVI-----ASI 309

  Fly   463 ILIALLIAAWGLMYMTRYASP--HYVPPMMTAYKVIMMTTTYCYILHICIIWLDLYPPRSK---- 521
            |:..::|       .|.:.||  |.:|..:.  ||.:.|     |.:|........|.|.|    
  Rat   310 IITVIVI-------NTHHRSPSTHIMPEWVR--KVFIDT-----IPNIMFFSTMKRPSRDKQEKR 360

  Fly   522 -------------APGWLVRVINSNVLR------CILGLRFSDSTDYCDIQEN----PWHHMAKI 563
                         .||......:|.:::      .|.|:::...|...|.:.|    .|.::|.:
  Rat   361 IFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSAIEGVKYIAETMKSDQESNNASEEWKYVAMV 425

  Fly   564 LNNL 567
            ::::
  Rat   426 MDHI 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 44/260 (17%)
Chrna1NP_077811.1 LIC 21..447 CDD:273305 84/460 (18%)
Neur_chan_LBD 24..231 CDD:280998 40/233 (17%)
Neur_chan_memb 238..446 CDD:280999 43/220 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.