DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrnb3a

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_957514.1 Gene:chrnb3a ZFINID:ZDB-GENE-040108-1 Length:467 Species:Danio rerio

Alignment Length:392 Identity:76/393 (19%)
Similarity:139/393 (35%) Gaps:103/393 (26%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLA-YEQTSSLLQTRMH 262
            |.||...:.|::           |.|          :..::.|..:...|. .::.:.|:.|.:.
Zfish    40 FRGYQKWVRPVL-----------HAN----------DTITVRFGLKISQLVDVDEKNQLMTTNVW 83

  Fly   263 MMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNV-------LNGALQSMGQVLQSYELMVYA 320
            :...|.|.:|.|.|||:|.:.|...|...||.|.:.:       ..|:|.:        :.:|..
Zfish    84 LWEEWTDYKLRWNPEDYGGITSIRVPSETIWLPDIVLYENADGRFEGSLMT--------KAIVRF 140

  Fly   321 NGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNT 385
            ||:| ::.......|.|......:|.:|..|.::.|                             
Zfish   141 NGTI-MWTPPASYKSACTMDVTFFPFDRQNCSMKFG----------------------------- 175

  Fly   386 PSGWSF--TQMSVVLVENDSQRR---YNPKGMMQKMTGD-------------VAIEFTLQRNRSF 432
              .|::  |.:.:.||:....|:   .|.:..:...||.             :...|.|:|...|
Zfish   176 --SWTYDGTMVDLTLVDAYVDRKDFFDNGEWEILNATGQRGSRRDGIYSYPYLTYSFILKRLPLF 238

  Fly   433 YMTVFYLPLIACQMFLILSFVLRSTRRSSL-----ILIALLIAAWGLMYMTRYASPHYVPPMMTA 492
            |.....:|.:......:|.|.|.|.....|     :|::|.:  :.|:......|...|.|::..
Zfish   239 YTLFLIIPCLGLSFLTVLVFYLPSDEGEKLSLSTSVLVSLTV--FLLVIEEIIPSSSKVIPLIGE 301

  Fly   493 YKV-IMMTTTYCYILHICIIWLD-----LYPPRSKAPGWLVRVINSNVLRCILGLRFSDSTDYCD 551
            |.: ||:..|:..|:.:.:|.:.     .|.|  .|| |:..:....:.|.:.....:|...|.|
Zfish   302 YLLFIMIFVTFSIIVTVFVINVHHRSSATYHP--MAP-WVKSLFLQRLPRLLCMRGHTDRYQYPD 363

  Fly   552 IQ 553
            |:
Zfish   364 IE 365

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 42/243 (17%)
chrnb3aNP_957514.1 LIC 9..459 CDD:273305 76/393 (19%)
Neur_chan_LBD 32..236 CDD:280998 46/257 (18%)
Neur_chan_memb 243..456 CDD:280999 28/129 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.