DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and glra2

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_001161371.1 Gene:glra2 ZFINID:ZDB-GENE-090407-1 Length:448 Species:Danio rerio

Alignment Length:320 Identity:64/321 (20%)
Similarity:117/321 (36%) Gaps:97/321 (30%)


  Fly   201 GYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMMM 265
            ||.:.|.|               |.:....::..|:...||...|      :|:...:..:.:..
Zfish    54 GYDARIRP---------------NFKGPPVNVTCNIFINSFGSVT------ETTMDYRVNIFLRQ 97

  Fly   266 HWRDSRLVWKPEDFGSLESFEHPDL----------RIWKPHMNVLNGALQSMGQVLQSYELM-VY 319
            .|.|.||.:.          |:||.          .||||.:...|....:...|....:|: ::
Zfish    98 KWNDPRLAYS----------EYPDSSLDLDPSMLDSIWKPDLFFANEKGANFHDVTTDNKLLRIF 152

  Fly   320 ANGSITLYAQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRK-PIAPNEHV 383
            .:|:: ||:..|.|...|....:|:|.:..||.::|...|....:   ||::...| |:...:.:
Zfish   153 KDGTV-LYSIRLTLILSCPMDLKNFPMDVQTCTMQLESFGYTMND---LIFEWLDKGPVQVADGL 213

  Fly   384 NTPSGWSFTQMSVVLVENDSQ-----RRYNPKGMMQKMTGD---VAIEFTLQRNRSFYMTVFYLP 440
            ..|.         .|:.::..     :.||        ||.   :.::|.|:|...:|:...|:|
Zfish   214 TLPQ---------FLIRDEKDLGYCTKHYN--------TGKFTCIEVKFHLERQMGYYLIQMYIP 261

  Fly   441 LIACQMFLILSFVLRSTRRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTT 500
                                ||:::   |.:|...::...|:|..|...:|.  |:.|||
Zfish   262 --------------------SLLIV---ILSWVSFWINMDAAPARVALGITT--VLTMTT 296

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 45/237 (19%)
glra2NP_001161371.1 LIC 44..437 CDD:273305 64/321 (20%)
Neur_chan_LBD 45..251 CDD:280998 49/249 (20%)
Neur_chan_memb 258..434 CDD:280999 14/65 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.