DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and Chrna10

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_006229953.1 Gene:Chrna10 RGDID:620142 Length:492 Species:Rattus norvegicus

Alignment Length:407 Identity:81/408 (20%)
Similarity:148/408 (36%) Gaps:80/408 (20%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHM 263
            |..|.|.:.|:...:            |..|.::...||.|        :..::.:.:|...:.:
  Rat    83 FANYTSALRPVADTD------------QTLNVTLEVTLSQI--------IDMDERNQVLTLYLWI 127

  Fly   264 MMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYA 328
            ...|.|:.|.|.|:.:|.|::...|...:|:|.:.:.|.| .:......|..::|..:|::...|
  Rat   128 RQEWTDAYLHWDPKAYGDLDAIRIPSRLVWRPDIVLYNKA-DTQPPASASTNVVVRHDGAVRWDA 191

  Fly   329 QNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQ 393
            ..:..:|..||.:. :|.:...|.:..|.....|.:.      |.|           |.|   |.
  Rat   192 PAITRSSCRVDVSA-FPFDAQRCGLTFGSWTHGGHQL------DVR-----------PRG---TS 235

  Fly   394 MSVV-LVEN--------DSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLI 449
            .|:. .|||        .::||....|...:...||.....|:|..:.|:....||.:...:...
  Rat   236 ASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYVCNLLLPCVFISLLAP 300

  Fly   450 LSFVL--RSTRRSSL-ILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICII 511
            |:|.|  .|..:.|| :.:.|.:..:.|:..........||.:...|...|...|:...|.|.|:
  Rat   301 LAFHLPADSGEKVSLGVTVLLALTVFQLILAESMPPAESVPLIGKYYMATMTMVTFSTALTILIM 365

  Fly   512 WLDLYPPRS-KAPGWLVRVINSNVLRCILGLRFSDSTDYCDIQE----------------NPWH- 558
            .|....|.: ..|.|...::..::.:   ||...:..:.|...:                .|.| 
  Rat   366 NLHYCGPNAHPVPAWARVLLLGHLAK---GLCVRERGEPCGQSKPLESAPSLQPPPASPAGPCHE 427

  Fly   559 -----HMAKILNNLSSI 570
                 |...:|::::||
  Rat   428 PRCLCHQEALLHHIASI 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 45/226 (20%)
Chrna10XP_006229953.1 LIC 60..476 CDD:273305 81/408 (20%)
Neur_chan_LBD 77..280 CDD:280998 49/239 (21%)
Neur_chan_memb 288..482 CDD:280999 31/161 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.