DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and htr3a

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_009293684.1 Gene:htr3a ZFINID:ZDB-GENE-071012-5 Length:482 Species:Danio rerio

Alignment Length:411 Identity:78/412 (19%)
Similarity:149/412 (36%) Gaps:87/412 (21%)


  Fly   182 SFSSFGSNTARW----------FYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANL 236
            |....|:||.|:          |...   ||...:.| |::..::..:...|.:.|         
Zfish    22 SVKKLGNNTGRFANATLVRLNEFLSA---GYKKGVRP-VRDWRQSTTVAIDLMVYA--------- 73

  Fly   237 SSISFHFQTRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLN 301
                      .|..::.:.:|.|.:.....|.|..|:|.||:|..::....|...||.|  ::|.
Zfish    74 ----------ILNVDEKNQVLTTYVWYRQQWTDEFLMWDPEEFDEVKKISIPTANIWIP--DILI 126

  Fly   302 GALQSMGQVLQSYELMVYANGSITLYAQNLQLASWCVDSARNWPSERVTCDI--ELGLNGQEGQE 364
            .....:|:......:.|..:|.::.| :.:|:.:.|..:..|:|.:...|.:  :..|:..: ..
Zfish   127 NEFVDVGKSPDIPYVYVGHDGLVSNY-KPIQVVTACSLNIYNFPYDVQKCSLTFQSWLHTTK-DI 189

  Fly   365 NVALIYDDQRKPIAPNEHVNTPSG-------WSFTQM----SVVLVENDSQRRYNPKGMMQKMTG 418
            |:.|:    |.|    |.|.|...       |....:    :...::||.            ...
Zfish   190 NITLM----RSP----EAVKTDKSVFMNQGEWELLHVLSTYNAFSIDNDD------------YYA 234

  Fly   419 DVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL---RSTRRSSLILIALLIAAWGLMYMTRY 480
            ::.....::|...||.....||.:...:..|:.|.|   ...|.|..|.:.|..:.:.::.....
Zfish   235 EMKFHVVIRRRPLFYTVNLLLPSMFLMVMDIVGFYLPPDSGERVSFKITLLLGYSVFLIIVSDTL 299

  Fly   481 ASPHYVPPMMTAYKVIMMTTTYCYILH-ICIIWL----DLYPPRSKAPGWLVRVI--NSNVLRCI 538
            .:.....|::..|.|:.|......:.. :.|:.|    ||   :|:.|.|:..::  .:.||.||
Zfish   300 PATAIGTPLIGVYFVVCMALLVISLTESVLIVRLVHKQDL---QSRVPQWVKHLVLEKATVLLCI 361

  Fly   539 LGLRF----SDSTDYCDIQEN 555
            ...:.    |..:|....:||
Zfish   362 RNKKICSFRSQGSDLPLYKEN 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 4/9 (44%)
Neur_chan_LBD 212..429 CDD:280998 38/230 (17%)
htr3aXP_009293684.1 LIC 21..479 CDD:273305 78/412 (19%)
Neur_chan_LBD 40..246 CDD:280998 43/253 (17%)
Neur_chan_memb 253..479 CDD:280999 28/134 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.