DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and htr3b

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_021324909.1 Gene:htr3b ZFINID:ZDB-GENE-071012-4 Length:369 Species:Danio rerio

Alignment Length:336 Identity:67/337 (20%)
Similarity:108/337 (32%) Gaps:111/337 (33%)


  Fly   166 PLLQFIDEAP--LVINYLSFSSFGSNTARWFYDCGFDGYGSEIAPIVKEETKTEKLLSHLNIQAE 228
            ||.:.:.|.|  ..:|.|:......      |:||       :.| |:..||...:...|.||| 
Zfish    15 PLAELVPEKPKRSALNQLTRLLLRK------YNCG-------VRP-VQNWTKPTTIYIDLIIQA- 64

  Fly   229 NASMPANLSSISFHFQ--TRSLAYEQTSSLLQTRMHMMMHWRDSRLVWKPEDFGSLESFEHPDLR 291
                   :..:....|  |.|:.|.|.             |.|..|||.|::|..:.........
Zfish    65 -------VLDVDGQTQKVTTSIWYRQI-------------WNDEFLVWDPDEFDGITEISLSSDA 109

  Fly   292 IWKPHMNV------------------LNGALQSMG--QVLQSYELMVYANGSITLYAQN--LQLA 334
            ||.|.:.:                  .:|.:::..  ||:.:..|.:||   .....||  |...
Zfish   110 IWVPDLIISEFVDVGKSPVIPYVYVNCSGKVKNYKPIQVVSACHLEIYA---FPFDKQNCTLTFR 171

  Fly   335 SWC-----VDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTPSGWSFTQM 394
            ||.     ||.|...|:|.:..|....:|..|.                  |.:..||       
Zfish   172 SWLHSVSEVDLALWRPAEEIANDTREFMNDGEW------------------ELLGVPS------- 211

  Fly   395 SVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSFVL----- 454
                       ||....:..:....:.....::|....|:....:|.|...:..::||.|     
Zfish   212 -----------RYWTLNLEDRDYAQIQFNVLIRRRPLLYVVGLLIPSIFLMVVDVISFYLPPNSG 265

  Fly   455 -RSTRRSSLIL 464
             |.|.::|::|
Zfish   266 TRITFKTSILL 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052 6/27 (22%)
Neur_chan_LBD 212..429 CDD:280998 46/246 (19%)
htr3bXP_021324909.1 Neur_chan_LBD 26..>325 CDD:332142 63/326 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.