DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and CHRNA10

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:NP_065135.2 Gene:CHRNA10 HGNCID:13800 Length:450 Species:Homo sapiens

Alignment Length:413 Identity:82/414 (20%)
Similarity:147/414 (36%) Gaps:84/414 (20%)


  Fly   199 FDGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHM 263
            |..|.|.:.|:...:            |..|.::...||.|        :..::.:.:|...:.:
Human    38 FANYTSALRPVADTD------------QTLNVTLEVTLSQI--------IDMDERNQVLTLYLWI 82

  Fly   264 MMHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGA-LQSMGQVLQSYELMVYANGSITLY 327
            ...|.|:.|.|.|..:|.|::...|...:|:|.:.:.|.| .|..|..  |..:::..:|::...
Human    83 RQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSA--STNVVLRHDGAVRWD 145

  Fly   328 AQNLQLASWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPN-----EHVNTPS 387
            |..:..:|..||.|. :|.:...|.:..|.....|.:     .|.:.:..|.:     |:|.   
Human   146 APAITRSSCRVDVAA-FPFDAQHCGLTFGSWTHGGHQ-----LDVRPRGAAASLADFVENVE--- 201

  Fly   388 GWSFTQMSVVLVENDSQRRYNPKGMMQKMTGDVAIEFTLQRNRSFYMTVFYLPLIACQMFLILSF 452
             |....|       .::||....|...:...||.....|:|..:.|:....||.:...:...|:|
Human   202 -WRVLGM-------PARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYVCNLLLPCVLISLLAPLAF 258

  Fly   453 VL--RSTRRSSL-ILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVIMMTTTYCYILHICIIWLD 514
            .|  .|..:.|| :.:.|.:..:.|:..........||.:...|...|...|:...|.|.|:.|.
Human   259 HLPADSGEKVSLGVTVLLALTVFQLLLAESMPPAESVPLIGKYYMATMTMVTFSTALTILIMNLH 323

  Fly   515 LYPPRSK-APGWLVRVINSNVLRCILGLRFSDSTDYC------DIQENP---------------- 556
            ...|..: .|.|...::..::.|   ||...:..:.|      ::..:|                
Human   324 YCGPSVRPVPAWARALLLGHLAR---GLCVRERGEPCGQSRPPELSPSPQSPEGGAGPPAGPCHE 385

  Fly   557 ----------WHHMAKILNNLSS 569
                      .||:|.|.|...|
Human   386 PRCLCRQEALLHHVATIANTFRS 408

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 44/223 (20%)
CHRNA10NP_065135.2 LIC 31..442 CDD:273305 82/414 (20%)
Neur_chan_LBD 32..235 CDD:280998 48/236 (20%)
Neur_chan_memb 243..434 CDD:280999 33/170 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.