DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NtR and chrnb5b

Sequence 1:NP_651958.2 Gene:NtR FlyBaseID:FBgn0029147 Length:585 Species:Drosophila melanogaster
Sequence 2:XP_017214550.1 Gene:chrnb5b ZFINID:ZDB-GENE-120809-5 Length:475 Species:Danio rerio

Alignment Length:372 Identity:70/373 (19%)
Similarity:134/373 (36%) Gaps:110/373 (29%)


  Fly   200 DGYGSEIAPIVKEETKTEKLLSHLNIQAENASMPANLSSISFHFQTRSLAYEQTSSLLQTRMHMM 264
            |.|...|.|.|.:..:..     :.||...|.:               ::..:...::.|...:.
Zfish    36 DRYNKLIRPAVNKSQQVT-----IAIQVSLAQL---------------ISVNEREQIMTTNCWLT 80

  Fly   265 MHWRDSRLVWKPEDFGSLESFEHPDLRIWKPHMNVLNGALQSMGQVLQSYELMVYANGSITLYAQ 329
            ..|.|.||:|.||::..:.....|...||.|.:.:.|.|       ..:||:..|:|..:   :.
Zfish    81 QVWNDYRLMWDPEEYEGMRKVRLPSQHIWLPDIVLYNNA-------DGTYEVSFYSNAVV---SN 135

  Fly   330 NLQLA--------SWCVDSARNWPSERVTCDIELGLNGQEGQENVALIYDDQRKPIAPNEHVNTP 386
            |.::|        |.|....|::|.::..|.::.                               
Zfish   136 NGEVAWLPPAIYKSACKIEVRDFPFDQQNCTLKF------------------------------- 169

  Fly   387 SGWSF--TQMSVVLVENDSQR-RYNPKGM--MQKMTG------------DVAIEFTLQRNRSFYM 434
            ..|::  |::.::|:.:.:.| .:.|.|.  :..:.|            |:..:|.::|...||.
Zfish   170 RSWTYDHTEIDLILLSDFASRDDFKPSGEWDIVSLPGRKNEDPNDVTYLDITYDFIIRRKPLFYT 234

  Fly   435 TVFYLPLIACQMFLILSFVLRST--RRSSLILIALLIAAWGLMYMTRYASPHYVPPMMTAYKVI- 496
            ....:|.:......||.|.|.|.  .:.:|.:..||.....|:.:::     .|||...|..:| 
Zfish   235 INLIIPCVLITSLAILVFYLPSDCGEKITLCISVLLALTVFLLLISK-----IVPPTSLAVPLIG 294

  Fly   497 ------MMTTTYCYILHICIIWLDLY---PPRSKAPGW-----LVRV 529
                  |:..|:..:..:|:  |:::   |.....|.|     |||:
Zfish   295 KYLMFTMVLVTFSIVTSVCV--LNVHHRSPSTHSMPKWVKYYFLVRL 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NtRNP_651958.2 Methyltransf_FA 90..191 CDD:289052
Neur_chan_LBD 212..429 CDD:280998 38/242 (16%)
chrnb5bXP_017214550.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3645
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.